Recombinant Chicken Phosphatidylserine synthase 2 (PTDSS1)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

PTDSS1 belongs to the phosphatidylserine synthase family, which facilitates the base-exchange reaction of serine with phosphatidylcholine (PC) or phosphatidylethanolamine (PE) to produce PS . In chickens, recombinant PTDSS1 is expressed in E. coli with an N-terminal His tag for purification . PS serves as a precursor for phosphatidylethanolamine and phosphatidylcholine, essential for membrane integrity and signaling .

Key Functions:

  • Phospholipid Synthesis: Converts PC/PE to PS, maintaining membrane asymmetry .

  • Disease Relevance: Linked to lipid metabolism disorders, oncogenic pathways, and bacterial colonization .

A. Cancer Biology

  • B Cell Lymphoma: PTDSS1 inhibition reduces PS and PE levels, destabilizing membranes and triggering B cell receptor hyperactivation, leading to apoptosis .

  • Tumor Lipidome: PTDSS1 depletion in mammary tumors lowers ether-PS levels, suppressing tumor growth and macrophage infiltration .

B. Infectious Disease

  • Lyme Disease: Borrelia burgdorferi colonization in ticks relies on PTDSS1-mediated phospholipid pathways, particularly PS-derived phosphatidylcholine synthesis .

C. Metabolic Studies

  • Phospholipid Imbalance: PTDSS1 knockout models reveal compensatory mechanisms in PE and PI metabolism, highlighting its role in lipid homeostasis .

Production and Quality Control

Recombinant Chicken PTDSS1 is produced via codon-optimized E. coli expression systems . Critical steps include:

  1. Cloning: Full-length cDNA (1-442 aa) fused to His tag.

  2. Purification: Affinity chromatography using Ni-NTA resins.

  3. Validation: SDS-PAGE and Western blotting confirm purity and identity .

Stability Considerations:

  • Avoid freeze-thaw cycles; reconstitute in sterile water with 50% glycerol for long-term storage .

Functional Insights from Mutant Models

  • PTDSS1 Knockout (KO): In B cell lymphoma, KO reduces PS/PE levels by ~50% and increases phosphoinositides (e.g., PI4P), altering calcium signaling and apoptosis .

  • Substrate Specificity: Prefers phosphatidylcholine over phosphatidylethanolamine in mammals, though chicken orthologs may exhibit variations .

Challenges and Future Directions

  • Nomenclature Conflicts: The designation "Synthase 2" for PTDSS1 in chickens contrasts with mammalian systems, where PTDSS1 typically refers to Synthase 1 .

  • Therapeutic Potential: Targeting PTDSS1 in cancers and infections requires deeper mechanistic insights .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for customers.
Shelf Life
Shelf life depends on various factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C; lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us; we will prioritize its development.
Synonyms
PTDSS1; Phosphatidylserine synthase 2; PSS-2; PtdSer synthase 2; Serine-exchange enzyme II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-442
Protein Length
full length protein
Species
Gallus gallus (Chicken)
Target Names
PTDSS1
Target Protein Sequence
MRRGERRGPAGPLGDGPALGLRRSTESEVYDDGTNTFFWRAHTLTVLFILTCALGYVTLL EETPQDTAYNTKRGIVASILVFLCFGVTQAKDGPFSRPHPAYWRFWLCVSVVYELFLIFI LFQTVQDGRQFMKYIDPHLGVPLPERDYGGNCLIYDPGNESDPFHNIWDKLDGFVPAHFF GWYLKTLMIRDWWMCMIISVMFEFLEYSLEHQLPNFSECWWDHWIMDVILCNGLGIYCGM KTLSWLSLKTYKWQGLWNIPTYKGKMKRIVFQFTPYSWVKFEWKPASSLRRWLAVCGIIF VFLLAELNTFYLKFVLWMPPEHYLVLLRLVFFVNVGGVAMREIYDFMDDPKFHKKLGQQA WLVAAITATEFLIVVKYDPYTLTLSLPFYITQCWILGIILVLTWTAWRFFIRDITLRYKE IRRQKQEHKYEKDKCLSNGDGH
Uniprot No.

Target Background

Function
Recombinant Chicken Phosphatidylserine synthase 2 (PTDSS1) catalyzes a base-exchange reaction replacing the polar head group of phosphatidylethanolamine (PE) or phosphatidylcholine (PC) with L-serine. It specifically catalyzes phosphatidylethanolamine conversion and does not act on phosphatidylcholine. Both phosphatidylethanolamine (PE) plasmalogen and diacyl PE serve as substrates, with the latter exhibiting six times greater utilization, highlighting the importance of an ester linkage at the sn-1 position. While showing no sn-1 fatty acyl preference, the enzyme displays a significant preference for docosahexaenoic acid (22:6n-3) over 18:1 or 20:4 at the sn-2 position.
Database Links
Protein Families
Phosphatidyl serine synthase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the molecular function of chicken PTDSS1 and how does it differ from PTDSS2?

Chicken PTDSS1 (Phosphatidylserine synthase 1) catalyzes a base-exchange reaction in which the polar head group of phosphatidylethanolamine (PE) or phosphatidylcholine (PC) is replaced by L-serine. While both PTDSS1 and PTDSS2 create phosphatidylserine, they exhibit distinct substrate preferences. PTDSS1 predominantly catalyzes the conversion of phosphatidylcholine to phosphatidylserine in cellular membranes, though it can also convert phosphatidylethanolamine to a lesser extent. In contrast, PTDSS2 is specific for phosphatidylethanolamine as a substrate and does not act on phosphatidylcholine .

These functional differences have important implications for experimental design when studying phospholipid metabolism and synthesis. Researchers investigating the differential roles of these enzymes should implement substrate-specific assays to distinguish between PTDSS1 and PTDSS2 activities, particularly when both enzymes are expressed in the same tissue or cell type.

What is the subcellular localization of chicken PTDSS1 and why is it important?

Chicken PTDSS1 primarily localizes to the mitochondria-associated membranes (MAMs) of the endoplasmic reticulum, where it serves both structural and signaling roles . This specific localization is critical for its function as phosphatidylserine production needs to occur at membrane contact sites to facilitate proper lipid distribution throughout the cell. Recent research has also demonstrated that phosphatidylserine enrichment in the nuclear membrane regulates important cellular processes .

When studying chicken PTDSS1, researchers should employ subcellular fractionation techniques combined with immunofluorescence microscopy to accurately characterize its distribution. Disruption of this localization pattern can lead to altered phospholipid metabolism and potentially impact cellular processes dependent on proper phosphatidylserine distribution.

What is the protein structure of chicken PTDSS1 and what functional domains are critical for its activity?

Chicken PTDSS1 is a multi-pass membrane protein containing multiple transmembrane domains. While the complete crystal structure has not been fully resolved, sequence analysis and comparative studies indicate that PTDSS1 belongs to the phosphatidylserine synthase family . The N-terminal region (approximately positions 1-35) contains sequences important for membrane insertion and enzyme function .

To characterize functional domains, researchers can employ site-directed mutagenesis approaches targeting conserved residues, followed by activity assays to determine their importance. Chimeric constructs combining domains from PTDSS1 and PTDSS2 can also be created to identify regions responsible for substrate specificity. Additionally, protein purification strategies should account for PTDSS1's hydrophobic nature as a membrane protein, often requiring detergent-based extraction methods while maintaining the native conformation.

What are the optimal expression systems for producing recombinant chicken PTDSS1?

Multiple expression systems can be utilized for recombinant chicken PTDSS1 production, each with distinct advantages. Based on current research methodologies, these systems include:

Expression SystemAdvantagesDisadvantagesTypical YieldRecommended Applications
E. coliCost-effective, rapid growth, high yieldsLacks post-translational modifications, membrane protein folding challenges≥85% purity with SDS-PAGE verification Structural studies, antibody production
Baculovirus/Insect CellsBetter post-translational modifications, improved membrane protein foldingMore expensive, slower productionVariable, typically 60-80%Functional studies requiring proper folding
Mammalian Cells (CHO, HEK293)Native-like post-translational modifications, best for functional studiesMost expensive, lower yields40-60%Activity assays, interaction studies
Cell-Free ExpressionRapid, avoids toxicity issuesLimited post-translational modificationsVariableInitial screening, functional domain analysis

For functional studies that require proper membrane insertion and post-translational modifications, mammalian expression systems are recommended despite their higher cost. For structural studies or antibody production where large quantities of protein are needed, E. coli systems optimized for membrane protein expression may be sufficient . Regardless of the system chosen, verification of proper folding and activity is essential before proceeding with experiments.

What purification methods are most effective for recombinant chicken PTDSS1?

Purifying recombinant chicken PTDSS1 presents challenges due to its integral membrane nature. A multi-step purification strategy is typically required:

  • Membrane Protein Extraction: Use of mild detergents such as n-dodecyl-β-D-maltoside (DDM) or digitonin to solubilize PTDSS1 while preserving its native conformation and activity.

  • Affinity Chromatography: When expressed with tags (His, GST, or biotin), affinity purification can be employed as an initial capture step. For chicken PTDSS1 expressed with N-terminal or C-terminal tags, metal affinity chromatography yields preparations with ≥85% purity .

  • Size Exclusion Chromatography: This serves as a polishing step to separate monomeric PTDSS1 from aggregates and other contaminants.

  • Quality Control: SDS-PAGE analysis followed by western blotting with specific antibodies (such as ABIN1955879 ) should be performed to confirm purity and integrity.

When designing purification strategies, researchers should verify enzyme activity at each step to ensure the purification process preserves functional integrity. Additionally, protein stability is enhanced by including glycerol in storage buffers and maintaining membranes in a phospholipid-rich environment.

What assays can be used to measure chicken PTDSS1 enzymatic activity?

Several complementary approaches can be employed to measure chicken PTDSS1 activity:

  • Radioisotope Labeling: Incorporating radiolabeled serine (³H or ¹⁴C) into phospholipids provides a quantitative measure of PS synthesis. This method offers high sensitivity but requires special handling of radioactive materials.

  • Mass Spectrometry-Based Assays: Liquid chromatography coupled with mass spectrometry (LC-MS/MS) enables precise quantification of phospholipid species, allowing researchers to monitor substrate depletion and product formation without radiolabels.

  • Fluorescent Phospholipid Analogs: Utilizing fluorescently labeled PE or PC substrates enables real-time monitoring of enzymatic activity through spectrofluorimetric methods.

  • Coupled Enzyme Assays: Indirect measurement of PTDSS1 activity by coupling PS production to subsequent enzymatic reactions that generate detectable signals.

When conducting activity assays, researchers should control for temperature, pH, and the presence of divalent cations, as these factors significantly influence PTDSS1 activity. Additionally, comparison with known PTDSS1 inhibitors or competitive substrates can validate assay specificity.

How does chicken PTDSS1 differ from mammalian orthologs in structure and function?

Comparative analysis of chicken PTDSS1 with mammalian orthologs reveals several important differences:

FeatureChicken PTDSS1Human PTDSS1Mouse PTDSS1
Sequence IdentityReference~75-80%~75-78%
Substrate PreferencePC > PEPC > PEPC > PE
Tissue DistributionWidespread, enriched in brain and liverWidespread, enriched in brainWidespread, enriched in brain
RegulationNot fully characterizedPost-translational modifications, feedback inhibitionTranscriptional control, feedback inhibition
Disease AssociationsNot well documentedLenz-Majewski hyperostotic dwarfism Not well documented

Despite these differences, the core enzymatic function of chicken PTDSS1 - catalyzing the base-exchange reaction to produce phosphatidylserine - remains conserved across species. Comparative studies examining enzyme kinetics and substrate specificity between chicken and mammalian PTDSS1 can provide valuable insights into structure-function relationships and evolutionary adaptations.

Researchers working with chicken PTDSS1 as a model should carefully consider these differences when extrapolating findings to mammalian systems, particularly in studies related to regulation and interaction with other cellular components.

What are the key differences between avian PTDSS1 and PTDSS2 that researchers should consider?

When designing experiments involving avian phosphatidylserine synthases, researchers should be aware of several critical differences between PTDSS1 and PTDSS2:

  • Substrate Specificity: Avian PTDSS1 can utilize both phosphatidylcholine and phosphatidylethanolamine as substrates (with preference for PC), while PTDSS2 is specific for phosphatidylethanolamine and does not act on phosphatidylcholine .

  • Cellular Distribution: While both enzymes localize to the endoplasmic reticulum, they may occupy distinct subdomains and potentially respond differently to cellular signals and stresses.

  • Tissue Expression Patterns: Expression levels of PTDSS1 and PTDSS2 vary across tissues, potentially reflecting specialized functions in different cell types.

  • Regulation Mechanisms: Evidence suggests different regulatory mechanisms control PTDSS1 and PTDSS2 activity, including potential differences in transcriptional control and post-translational modifications.

These differences have important implications for experimental design, particularly when investigating phospholipid metabolism in avian systems. Selective inhibition or knockdown studies should be carefully designed with appropriate controls to distinguish between PTDSS1 and PTDSS2 activities.

How can recombinant chicken PTDSS1 be used in membrane biophysics research?

Recombinant chicken PTDSS1 offers valuable applications in membrane biophysics research:

  • Reconstitution Systems: Purified PTDSS1 can be incorporated into synthetic liposomes or nanodiscs to study membrane curvature effects and lipid domain formation. This approach allows precise control over membrane composition and enables investigation of how phosphatidylserine distribution affects membrane properties.

  • Membrane Asymmetry Studies: PTDSS1 can be used to generate asymmetric membranes with phosphatidylserine preferentially distributed in one leaflet, mimicking the natural asymmetry of biological membranes.

  • Biophysical Techniques: Using techniques such as nuclear magnetic resonance (NMR), atomic force microscopy (AFM), and small-angle X-ray scattering (SAXS), researchers can investigate how PTDSS1-mediated PS production alters membrane organization, fluidity, and domain formation.

  • Interaction with Membrane Proteins: Studying how PTDSS1-generated phosphatidylserine influences the function and organization of membrane proteins can provide insights into lipid-protein interactions in biological membranes.

When designing these experiments, researchers should consider the lipid composition of the membrane systems, as this significantly impacts PTDSS1 activity and the properties of the resulting membranes containing synthesized phosphatidylserine.

What are the implications of PTDSS1 in neurodevelopmental research models?

Phosphatidylserine synthase 1 has significant implications for neurodevelopmental research:

  • Synaptic Membrane Dynamics: Recent studies indicate that phosphatidylserine directly binds and stabilizes certain ion channels at the synaptic membrane . Recombinant chicken PTDSS1 can be used to investigate how controlled PS production affects synaptic protein localization and function.

  • Nuclear Membrane Regulation: Phosphatidylserine enrichment in the nuclear membrane regulates critical processes , suggesting PTDSS1 may influence nuclear functions relevant to neuronal development and differentiation.

  • Disease Modeling: Human PTDSS1 mutations cause Lenz-Majewski hyperostotic dwarfism, which includes neurological manifestations . Chicken PTDSS1 models can help understand the conserved pathways affected in this condition.

  • Cell Signaling in Neurodevelopment: PS serves as an important signaling molecule in neuronal cells, and chicken PTDSS1 models can elucidate species-specific aspects of this signaling in avian neural development.

Researchers investigating these aspects should combine genetic approaches (overexpression, knockdown) with direct enzyme supplementation to distinguish between developmental and acute effects of altered phosphatidylserine production.

How can protein-lipid interaction studies be designed using recombinant chicken PTDSS1?

Investigating protein-lipid interactions involving chicken PTDSS1 requires specialized approaches:

  • Lipid Strip Binding Assays: As demonstrated with other lipid-interacting proteins, PIP strips pre-blocked with bovine serum albumin (BSA) can be incubated with purified PTDSS1 fusion proteins to identify specific lipid binding partners . This approach allows screening of multiple lipid species simultaneously.

  • Surface Plasmon Resonance (SPR): SPR technology provides quantitative measurements of PTDSS1 binding to various lipids, enabling determination of binding kinetics and affinity constants.

  • Fluorescence Resonance Energy Transfer (FRET): By labeling PTDSS1 and target lipids with appropriate fluorophore pairs, researchers can monitor protein-lipid interactions in real-time, including in cellular contexts.

  • Crosslinking Studies: Chemical crosslinking coupled with mass spectrometry can identify specific residues involved in PTDSS1-lipid interactions, providing detailed structural information.

To ensure specificity, these experiments should include appropriate controls such as heat-denatured protein, competitive binding assays, and comparison with structurally related proteins that lack lipid-binding activity.

What are common issues in recombinant chicken PTDSS1 expression and how can they be addressed?

Researchers frequently encounter several challenges when expressing recombinant chicken PTDSS1:

ChallengePotential CausesSolutions
Low Expression YieldsToxicity to host cells, protein instabilityUse inducible expression systems, lower induction temperature (16-20°C), include specific chaperones
Protein AggregationImproper folding, excessive overexpressionOptimize detergent type and concentration, use fusion partners (MBP, SUMO) to enhance solubility
Loss of Enzymatic ActivityDenaturation during purification, critical cofactor absenceInclude glycerol and lipids in buffers, verify proper membrane insertion
Proteolytic DegradationExposure to host cell proteasesAdd protease inhibitors throughout purification, use protease-deficient host strains
Poor PurityNon-specific binding to purification resinsOptimize wash conditions, consider multiple purification steps

When troubleshooting expression issues, a systematic approach is recommended: first optimize the expression vector (codon usage, promoter strength), then the host strain and growth conditions, followed by induction parameters and purification conditions. Each parameter should be tested individually while keeping others constant to identify the specific factors limiting expression or activity.

How can researchers address challenges in measuring chicken PTDSS1 activity in complex biological samples?

Measuring PTDSS1 activity in complex biological samples presents several methodological challenges:

  • Background Activity: Endogenous phospholipases and other enzymes can interfere with PTDSS1 activity measurements. Solution: Include specific inhibitors of competing pathways and use PTDSS1-specific substrates or conditions.

  • Substrate Availability: Limited accessibility of phospholipid substrates in membrane preparations. Solution: Optimize detergent concentration to solubilize membranes without denaturing PTDSS1.

  • Product Quantification: Difficulty distinguishing newly synthesized PS from endogenous pools. Solution: Use isotope labeling (³H-serine or ¹³C-serine) to track newly synthesized phosphatidylserine.

  • Activity Preservation: Loss of activity during sample preparation. Solution: Minimize time between tissue/cell harvesting and enzyme assays, maintain samples at 4°C, and include stabilizing agents such as glycerol.

  • Assay Validation: Confirming assay specificity for PTDSS1 versus PTDSS2. Solution: Use comparative assays with both PC and PE substrates, and include specific inhibitors when available.

When designing these experiments, researchers should always include appropriate controls such as heat-inactivated samples and specific activity inhibitors to establish accurate baseline measurements.

What strategies can address antibody cross-reactivity issues when studying chicken PTDSS1?

Antibody specificity is crucial for accurate characterization of chicken PTDSS1:

  • Epitope Selection: Choose unique regions of chicken PTDSS1 that differ from PTDSS2 and other related proteins. The N-terminal region (amino acids 1-35) has been successfully used for specific antibody generation .

  • Validation Methods:

    • Western blotting against recombinant PTDSS1 and PTDSS2

    • Immunohistochemistry with PTDSS1 overexpression and knockdown controls

    • Preabsorption tests with the immunizing peptide

    • Testing in PTDSS1-knockout cell lines or tissues (if available)

  • Alternative Detection Strategies: When antibody cross-reactivity cannot be resolved, consider:

    • Expression of tagged versions of chicken PTDSS1 (myc, HA, GFP)

    • RNA detection methods (qRT-PCR, in situ hybridization)

    • Activity-based protein profiling approaches

  • Polyclonal versus Monoclonal Considerations: While polyclonal antibodies offer higher sensitivity, carefully selected monoclonal antibodies may provide better specificity. Commercial options like ABIN1955879 (polyclonal, biotin-conjugated) have been validated for western blotting, ELISA, and immunohistochemistry in human samples and may require cross-reactivity testing for chicken applications .

What are emerging areas of research involving chicken PTDSS1?

Several promising research directions are emerging for chicken PTDSS1:

  • Comparative Genomics and Evolution: Investigating the evolutionary conservation and divergence of PTDSS1 across avian species can provide insights into phospholipid metabolism adaptation.

  • Developmental Biology: Exploring the role of PTDSS1 in avian embryonic development, particularly in tissues with high membrane dynamics such as the nervous system.

  • Cellular Stress Responses: Examining how PTDSS1 activity and regulation change under various cellular stresses (oxidative stress, ER stress, nutrient limitation) in avian systems.

  • Membrane Microdomains: Investigating how PTDSS1-generated phosphatidylserine contributes to the formation and maintenance of specialized membrane domains in avian cells.

  • Interactome Mapping: Identifying the protein interaction network of chicken PTDSS1 to better understand its regulation and cellular functions beyond enzymatic activity.

These emerging areas represent significant opportunities for researchers to contribute novel insights into phospholipid biology using chicken PTDSS1 as a model system.

What technological advances might enhance future research on chicken PTDSS1?

Several technological advances hold promise for advancing chicken PTDSS1 research:

  • CRISPR-Cas9 Gene Editing: Precise genetic modification of chicken cells or embryos to study PTDSS1 function in vivo.

  • Advanced Imaging Techniques: Super-resolution microscopy and correlative light-electron microscopy to visualize PTDSS1 localization and dynamics in cellular membranes.

  • Synthetic Biology Approaches: Engineered PTDSS1 variants with altered substrate specificity or regulation to probe structure-function relationships.

  • Computational Modeling: Molecular dynamics simulations of PTDSS1-membrane interactions to predict structural features important for function.

  • Single-Cell Technologies: Analysis of PTDSS1 expression and activity at the single-cell level to uncover cell-type-specific functions in complex tissues.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.