Recombinant Chicken Photoreceptor outer segment membrane glycoprotein 2

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, please specify your required tag type if you have preferences; we will prioritize its implementation.
Synonyms
Photoreceptor outer segment membrane glycoprotein 2; CRDS2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-364
Protein Length
full length protein
Species
Gallus gallus (Chicken)
Target Protein Sequence
MTVLKVKFTKTKRDKLAQILWILNWVSVVSGIILFSLGLFLKIEIKKRNEVMAKGDINSV PNMLISVGVIACVVNFLGGKICYDCSDANKFSRWKLIMLPYIICTFCFTFCILLGALMCY TMRNELEESLYLGLRDAIKFYKDTDIPGRCFLKKTVDMLQIGFQCCGNNGFRDWFEVQWV SARYLNMASKEVMDRFKSNVDGKFLVDGVPFSCCNPSSPRPCIQYHLTNNSAHYNYDFLT EELNIWVKGCREALLEYYTAIMRSIGIAALLIWLFELSVLIGVRYLQTAMKNVLLQGDLQ GESDGWLLENSFVETAKYNINIIKNLGKANQISTVSGMNDPNINVQNTNCGKSNVTAKSI PAAS
Uniprot No.

Target Background

Database Links

KEGG: gga:395898

STRING: 9031.ENSGALP00000014944

UniGene: Gga.531

Protein Families
PRPH2/ROM1 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is PRPH2 and what role does it play in photoreceptor cells?

PRPH2 (also known as peripherin-2 or rds) is a tetraspanin protein that localizes specifically to disc rims in photoreceptor outer segments. It forms the structural foundation for the highly curved, hairpin-shaped disc rims that are essential for proper outer segment architecture. PRPH2 assembles into homo- and heteromeric complexes with ROM1 (Rod Outer segment Membrane protein 1), which are further organized into larger oligomers connected by disulfide bonds . These oligomers form three parallel interconnected chains wrapped around the circumference of mature discs, providing structural support for the hairpin-shaped disc rims . Without PRPH2, as demonstrated in knockout mouse models (rds mice), photoreceptors completely fail to form outer segments, highlighting its critical role in photoreceptor development and function .

How do PRPH2 and ROM1 interact in photoreceptor disc formation?

PRPH2 and ROM1 form both homo- and heteromeric complexes within disc rims that are further assembled into larger oligomers through disulfide bonding . Their interaction follows a specific stoichiometry, with twice as much PRPH2 as ROM1 in mouse outer segments . While both proteins contribute to disc rim formation, ROM1 appears to be functionally redundant to PRPH2, as evidenced by studies showing that overexpression of PRPH2 can rescue the structural defects in ROM1 knockout mouse photoreceptors . This rescue includes normalization of disc enclosure timing, restoration of proper disc diameter, and reestablishment of incisures (indentations in disc rims) .

What methodologies are used to express recombinant PRPH2 for structural studies?

While the search results don't specifically address recombinant chicken PRPH2 expression systems, researchers typically employ several approaches for membrane protein expression:

  • Mammalian expression systems: HEK293 or CHO cells provide appropriate post-translational modifications

  • Insect cell systems: Baculovirus expression can yield higher protein quantities

  • Yeast expression: Pichia pastoris systems are useful for tetraspanin proteins

  • Bacterial systems: E. coli systems with specialized membrane protein expression strains

For PRPH2, expression systems must account for the protein's disulfide bonding requirements, which are essential for proper oligomerization. Successful recombinant expression requires careful consideration of the C-terminal region, which plays a specialized role in photoreceptor membrane retention .

How does PRPH2 compensate for ROM1 deficiency, and what are the implications for therapeutic approaches?

Research demonstrates a remarkable compensatory relationship between PRPH2 and ROM1. In ROM1 knockout mice, PRPH2 expression increases to approximately match the total tetraspanin (PRPH2+ROM1) content in wild-type mice . This is evidenced by quantitative analysis showing:

ParameterWild-type RatioROM1 Knockout Ratio
PRPH2:Rhodopsin~1:18~1:12
ROM1:Rhodopsin~1:36N/A
Total Tetraspanin:Rhodopsin~1:12~1:12

This compensatory mechanism suggests targeted gene therapy approaches where PRPH2 overexpression could potentially treat certain ROM1-associated retinal disorders. The research indicates that "a sufficient excess of PRPH2 is able to compensate for the loss of ROM1, indicating that ROM1 is redundant to PRPH2 as a molecular building block of photoreceptor disc rims" . This opens the possibility that "PRPH2 overexpression can prevent the long-term photoreceptor degeneration associated with either loss of ROM1 or deficiencies arising from mutations in PRPH2 itself" .

What are the ultrastructural changes in photoreceptor outer segments associated with PRPH2/ROM1 alterations?

Transmission electron microscopy (TEM) reveals distinct ultrastructural abnormalities in ROM1 knockout photoreceptors that provide insights into the protein's function:

  • Delayed disc enclosure: ROM1-deficient photoreceptors show a prolonged period where discs remain open to the extracellular space

  • Increased disc diameter: Without ROM1, discs grow wider than normal

  • Loss of incisures: The specialized indentations in disc rims are absent

  • Membrane overgrowth: Some ROM1-/- photoreceptors display uncontrolled disc membrane extension, occasionally wrapping around the entire outer segment

How do mutations in PRPH2 and ROM1 differentially affect photoreceptor pathophysiology?

Mutations in these two tetraspanin proteins manifest with distinctly different clinical and experimental phenotypes:

  • PRPH2 mutations: Approximately 200 different mutations cause a heterogeneous spectrum of inherited retinal diseases including retinitis pigmentosa, cone-rod dystrophy, and macular dystrophies . PRPH2 mutations typically cause dominant phenotypes, reflecting the protein's essential role.

  • ROM1 mutations: These primarily cause digenic retinitis pigmentosa in conjunction with PRPH2 mutations . Isolated ROM1 mutations without accompanying PRPH2 alterations are rarely reported to cause retinal disease, with only a handful of cases in the literature .

The differential impact of mutations in these genes reflects their distinct functional contributions. While both proteins participate in disc rim formation, PRPH2 has an additional essential role mediated by its C-terminal region, which is critically involved in the initial stages of disc morphogenesis . Additionally, the 2:1 ratio of PRPH2:ROM1 in photoreceptors (at least in mice) may explain the more severe consequences of PRPH2 mutations .

What animal models are available for studying PRPH2/ROM1 function?

Several genetically modified mouse models have been developed to study PRPH2 and ROM1 function:

Mouse ModelGenetic ModificationPhenotypeReference
rds (Prph2-/-)PRPH2 knockoutComplete failure of outer segment formation
Rom1-/-ROM1 knockoutForms outer segments with structural abnormalities
PRPH2 OEPRPH2 overexpression (~30% over wild-type)Normal but with enhanced PRPH2 levels
PRPH2 OE/Rom1-/-PRPH2 overexpression on ROM1 knockoutRescue of ROM1 knockout phenotype
Prph2 C150SMutation affecting disulfide bond formationAffects PRPH2 oligomerization
RRCTPRPH2 with ROM1 tetraspanin domainForms hairpin-shaped rims but disorganized discs

These models provide essential tools for investigating the specific contributions of each protein to outer segment morphogenesis and maintenance. The RRCT knockin mouse, where the tetraspanin body of PRPH2 was replaced with that of ROM1, is particularly informative as it demonstrates that "disc rims are still formed" even with this chimeric protein, though the photoreceptors "failed to form orderly disc stacks" .

What imaging and biochemical techniques are most effective for analyzing PRPH2/ROM1 complexes?

Research on PRPH2/ROM1 interactions employs several complementary techniques:

  • Transmission Electron Microscopy (TEM): Essential for visualizing outer segment ultrastructure, disc stacking, and rim morphology. This reveals detailed structural abnormalities such as "overgrown disc membranes not aligned in a stack" in ROM1 knockout mice .

  • Biochemical analysis: Quantitative protein analysis determines the molar ratios of PRPH2:ROM1:rhodopsin, critical for understanding compensatory mechanisms in genetic models .

  • Morphometric analysis: Quantification of structural parameters including outer segment length, width, and disc dimensions provides objective measures of photoreceptor organization .

  • Immunolocalization: Using specific antibodies to determine the precise subcellular localization of PRPH2 and ROM1.

  • Oligomeric state analysis: Assessment of protein complexes through non-reducing gel electrophoresis or crosslinking studies to understand the higher-order assembly of these proteins.

What are the critical controls needed when expressing recombinant PRPH2 in heterologous systems?

When producing recombinant PRPH2 for experimental studies, several critical controls must be implemented:

  • Expression validation: Confirmation of proper protein size, post-translational modifications, and folding through Western blotting and glycosylation analysis

  • Functional assays: Verification that recombinant PRPH2 retains membrane-shaping capabilities, which can be assessed in artificial membrane systems

  • Oligomerization assessment: Confirmation that recombinant PRPH2 forms appropriate homo-oligomers and hetero-oligomers with ROM1 when co-expressed

  • Subcellular localization: Microscopy verification that the recombinant protein targets to appropriate membrane domains

  • Species-specific controls: When studying chicken PRPH2, comparison with mammalian PRPH2 to identify species-specific structural or functional differences

How should researchers interpret contradictory findings in PRPH2/ROM1 studies?

When encountering contradictory findings in the literature, researchers should systematically evaluate:

  • Species differences: Results from chicken models may differ from mouse or human studies due to evolutionary divergence in PRPH2 function

  • Methodological variations: Expression systems, purification methods, and experimental conditions affect protein behavior

  • Isoform-specific effects: Different splice variants or post-translationally modified forms may exhibit distinct functions

  • Compensatory mechanisms: Redundancy between PRPH2 and ROM1 may mask phenotypes in certain experimental paradigms, as demonstrated by the observation that "ROM1 is redundant to PRPH2 as a molecular building block of photoreceptor disc rims"

  • Contextual dependencies: Protein function may vary depending on cellular context, developmental stage, or presence of interacting partners

What quantitative approaches are recommended for analyzing PRPH2/ROM1 ratio changes in experimental models?

Quantitative analysis of PRPH2/ROM1 ratios should include:

  • Standardized protein quantification: Using rhodopsin as an internal standard for normalization, as demonstrated in studies showing the PRPH2:rhodopsin ratio changes from ~1:18 in wild-type to ~1:12 in ROM1 knockout mice

  • Multiple technical replicates: To account for methodological variability

  • Biological replicates: Using "at least three biological replicates" as implemented in published studies

  • Statistical analysis: Appropriate statistical tests to determine significance of observed changes

  • Consideration of total tetraspanin content: Analysis of the combined PRPH2+ROM1 levels relative to other outer segment proteins provides insight into compensatory mechanisms

How can researchers distinguish between primary and secondary effects in PRPH2/ROM1 manipulations?

Distinguishing between direct consequences of PRPH2/ROM1 alterations and downstream effects requires:

  • Temporal analysis: Examining changes at multiple time points to establish sequence of events

  • Molecular intervention studies: Using targeted approaches to block specific pathways and determine causality

  • Rescue experiments: As demonstrated with PRPH2 overexpression rescuing ROM1 knockout phenotypes, providing strong evidence for functional redundancy

  • Domain-specific mutations: Creating chimeric proteins or targeted mutations to identify functional domains, as in the RRCT knockin mouse where the tetraspanin domain of PRPH2 was replaced with that of ROM1

  • Comprehensive phenotyping: Analyzing multiple parameters including biochemical composition, ultrastructure, and physiological function

What is the potential for gene therapy approaches targeting PRPH2 in photoreceptor diseases?

Gene therapy strategies targeting PRPH2 show significant promise based on recent research:

  • Overexpression therapy: Studies showing that PRPH2 overexpression rescues ROM1 knockout phenotypes suggest that "PRPH2 overexpression can prevent the long-term photoreceptor degeneration associated with either loss of ROM1 or deficiencies arising from mutations in PRPH2 itself"

  • Domain-specific approaches: The functional redundancy between certain domains of PRPH2 and ROM1 suggests that chimeric constructs might serve as therapeutic tools

  • Combined therapy: Co-delivery of PRPH2 and interacting partners to enhance therapeutic efficacy

  • Timing considerations: The observed delay in disc enclosure in ROM1 knockout mice suggests early intervention may be critical for preventing progressive structural deterioration

How does the GARP domain of CNG channels interact with PRPH2/ROM1 complexes?

The glutamic acid-rich protein (GARP) domain of the cyclic nucleotide-gated (CNG) channel's β1-subunit contains distinct functional regions that may interact with PRPH2/ROM1 complexes:

  • Targeting function: The glutamic acid-rich region encodes information directing the channel to rod outer segments

  • Connecting function: The proline-enriched region appears to connect the CNG channel to photoreceptor disk rims, potentially through interaction with peripherin-2 (PRPH2)

  • Plasma membrane sequestration: The interaction between the CNG channel and peripherin-2 may be required for proper sequestration of the channel to the outer segment plasma membrane

This interaction represents an important area for further investigation, as it connects the structural components of the disc rims (PRPH2/ROM1) with the functional components of phototransduction (CNG channels).

What are the methodological challenges in studying species-specific variations in PRPH2 function?

Researchers investigating species-specific variations in PRPH2 function face several methodological challenges:

  • Expression system selection: Finding appropriate heterologous systems that support proper folding and post-translational modifications of chicken versus mammalian PRPH2

  • Structural analysis: Obtaining high-resolution structural data for comparative analysis between species

  • Functional reconstitution: Developing membrane systems that allow assessment of the membrane-shaping properties of PRPH2 from different species

  • Interspecies chimeras: Creating and validating domain-swap experiments between chicken and mammalian PRPH2 to identify functionally divergent regions

  • Model system limitations: Addressing the challenges of studying chicken photoreceptors, which differ from mammalian photoreceptors in several aspects including oil droplet content and spectral sensitivity

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.