Recombinant Chicken Potassium voltage-gated channel subfamily A member 10 (KCNA10)

Shipped with Ice Packs
In Stock

Description

Table 1: Recombinant Chicken KCNA10 Variants

Product IDExpression SystemTagProtein LengthPurityPrice Range
KCNA10-6032C Mammalian CellsHisPartial/Full>80%Custom quote
RFL9622GF E. coliHisFull (1-516aa)>90%$1,310–$3,500
  • Source: Chicken (Gallus gallus), with UniProt ID Q7T199 and Gene ID 395116 .

  • Sequence: The full-length protein comprises 516 amino acids, including conserved voltage-sensing (S4) and pore-forming domains .

  • Storage: Lyophilized or liquid form, stable at -20°C to -80°C .

Key Functional Properties:

  • Voltage Sensitivity: Activates at depolarizing potentials (>-30 mV), with half-activation at +3.5 mV .

  • Ion Selectivity: Exhibits high K⁺-to-Na⁺ selectivity (ratio ≥15:1) .

  • Modulation: Inhibited by phorbol esters (e.g., PMA) via protein kinase C (PKC) activation .

  • Single-Channel Conductance: ~11 pS, measured in Xenopus oocytes .

Table 2: Functional Comparison with Human KCNA10

FeatureChicken KCNA10Human KCNA10
Amino Acid Length516511
Voltage Activation>-30 mVSimilar threshold
PKC SensitivityYesYes
Tissue DistributionSensory hair cells Kidney, heart

Role in Sensory Physiology

Studies in Kcna10–/– mice reveal critical roles for KCNA10 in vestibular hair cells (HCs):

  • Type I HCs: Mediates the low-voltage-activated conductance (IK,L), enabling rapid membrane repolarization and non-quantal synaptic transmission .

  • Type II HCs: Supports fast-inactivating (IA) and delayed rectifier (IDR) currents, essential for action potential shaping .

  • Residual Conductances: In knockout models, residual K⁺ currents involve KV7 (KCNQ) channels, highlighting compensatory mechanisms .

Research Applications

Recombinant Chicken KCNA10 is pivotal for:

  1. Electrophysiology: Characterizing voltage-gated currents in heterologous systems (e.g., oocytes, HEK293 cells) .

  2. Protein Interaction Studies: Mapping interactions with modulators like PKC or CNG channel blockers .

  3. Drug Discovery: Screening for channel inhibitors (e.g., verapamil, pimozide) .

Future Directions

Ongoing research aims to:

  • Elucidate structural determinants of KCNA10’s dual voltage- and cyclic nucleotide sensitivity.

  • Explore its role in avian auditory/vestibular systems compared to mammalian homologs.

  • Develop subtype-specific modulators for therapeutic targeting.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format readily available in our inventory. However, if you require a specific format, please indicate your preference during order placement. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All protein shipments are standardly accompanied by blue ice packs. If dry ice packaging is required, please inform us in advance. Additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution. Store at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers may use this as a reference point.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid protein is 6 months at -20°C/-80°C. The shelf life of lyophilized protein is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize development with your preferred tag.
Synonyms
KCNA10; Potassium voltage-gated channel subfamily A member 10
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-516
Protein Length
full length protein
Species
Gallus gallus (Chicken)
Target Names
KCNA10
Target Protein Sequence
MMDVSSWKEMEVALVSFDNADQIVEDPCYSNDLSPASQSRKGHPSCANLLSNWRILINSE NANNETIFSRFSAEFSEHLVGERVGMEEGDQRVIINIAGLRFETRLKTLNQFPETLLGDP EKRMRYFDSMRNEYFFDRNRPSFDGILYYYQSGGKIRRPANVPIDVFADEITFYELGDEA MDQFREDEGFIKDPETLLPTNDFHRQFWLLFEYPESSSAARGVALVSVLVIVISIIIFCM ETLPEFREEREYKSTQELSKNTTDTLLAHSTFTDPFFVIETACIIWFSFELFVRFIVCPS KTEFFKNIMNIIDIVSIIPYFVTLTTELIQQSELNGQQNMSLAILRIIRLVRVFRIFKLS RHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEVDEPQSHFSSIPDGFWWA VVTMTTVGYGDMCPTTLGGKIVGTLCAIAGVLTIALPVPVIVSNFNYFYHRETENEEKQI LPGEVERILNSVVTGNDSMESLNKTNGGYPRDKAKK
Uniprot No.

Target Background

Function
This protein mediates voltage-dependent potassium ion permeability of excitable membranes. It assumes opened or closed conformations in response to the voltage difference across the membrane, forming a potassium-selective channel. Potassium ions pass through this channel according to their electrochemical gradient. Channel activity is upregulated by cAMP.
Gene References Into Functions
  1. During chicken inner ear development, RT-PCR studies show expression of cKv1.2, cKv1.3 and cKv1.5 as early as Embryonic Day (ED) 3. cKCNA10 expression was detected at low levels starting on ED6 and was highly expressed by ED9. PMID: 14969738
Database Links
Protein Families
Potassium channel family, A (Shaker) (TC 1.A.1.2) subfamily, Kv1.8/KCNA10 sub-subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Detected in brain, cochlear sensory epithelium, cochlear ganglion, tegumentum vasculosum. Detected at low levels in cochlear lagena.

Q&A

What is KCNA10 and what are its main structural features?

KCNA10 (also known as KV1.8) is a voltage-gated potassium channel that belongs to the Shaker family (KV1) of potassium channels. Structurally, it shows approximately 58% amino acid identity with the K channel Shaker KV1.3 . The protein contains typical voltage-sensing domains and pore regions characteristic of voltage-gated potassium channels. While most research has focused on mammalian KCNA10, the chicken homolog is expected to maintain the core structural domains essential for voltage sensing and ion conductance, with species-specific variations in regulatory regions.

Where is KCNA10 primarily expressed in vertebrate tissues?

KCNA10 expression has been documented in kidney, heart, and aorta in mammals . In the inner ear, KCNA10 is found in vestibular hair cells, specifically in both type I and type II hair cells of the utricle . The expression pattern in chicken tissues is likely to parallel that of mammals, with potential tissue-specific variations that reflect the physiological adaptations of avian species. Researchers investigating chicken KCNA10 should focus initial expression studies on these tissues based on mammalian expression patterns.

What are the basic electrophysiological properties of KCNA10 channels?

KCNA10 mediates voltage-gated K+ currents with minimal steady-state inactivation. The channels are closed at negative holding potentials (e.g., -80 mV) and are progressively activated by depolarizations more positive than -30 mV, with half-activation at approximately +3.5 ± 2.5 mV . Single-channel analysis reveals a conductance of approximately 11 pS . KCNA10 exhibits a K-to-Na selectivity ratio of at least 15:1, confirming its strong preference for potassium ions .

What expression systems are optimal for recombinant chicken KCNA10 functional studies?

For heterologous expression of KCNA10, Xenopus laevis oocytes have been successfully used, generating ensemble currents of 5-10 μA at +40 mV . Based on experiences with mammalian KCNA10, researchers studying the chicken homolog should consider optimizing expression conditions in oocytes, as initial studies with rabbit KCNA10 showed lower expression levels (peak currents of 0.3 μA at +60 mV) . Alternatively, mammalian cell lines such as HEK293 or CHO cells may be suitable for certain applications, particularly when co-expression with modulatory subunits or interacting proteins is required.

What are the recommended approaches for measuring KCNA10 channel activity?

Whole-cell patch-clamp recording represents the gold standard for characterizing KCNA10 channel function. Voltage protocols should include:

  • Holding potentials around -80 mV

  • Depolarizing steps ranging from -70 mV to +60 mV

  • Tail current protocols for reversal potential determination

Single-channel recordings can provide additional insights into channel conductance and gating kinetics. For chicken KCNA10, researchers should start with protocols established for mammalian homologs, with adjustments based on preliminary data.

How can researchers differentiate KCNA10 currents from other potassium conductances?

KCNA10 displays a distinctive pharmacological profile that can help distinguish it from other channels. It is blocked by classical K+ channel blockers including barium, tetraethylammonium, and 4-aminopyridine . Uniquely, KCNA10 is also sensitive to inhibitors of cyclic nucleotide-gated (CNG) cation channels, such as verapamil and pimozide . This unusual inhibitor profile can serve as a functional signature when conducting electrophysiological studies on recombinant or native channels.

What cloning strategies are most effective for chicken KCNA10?

Based on experiences with mammalian KCNA10, researchers should consider RT-PCR approaches using primers designed from conserved regions across species. Starting with tissues known to express KCNA10 in mammals (kidney, heart, vestibular organs), researchers can amplify the chicken homolog. Full-length verification should follow using RACE (Rapid Amplification of cDNA Ends) techniques. Expression optimization might require codon optimization for the expression system of choice, as demonstrated by the improved expression of human KCNA10 compared to rabbit KCNA10 in oocytes .

What approaches can be used to study KCNA10 regulation at the transcriptional level?

For investigating transcriptional regulation of chicken KCNA10, researchers should:

  • Analyze the promoter region using bioinformatics to identify potential transcription factor binding sites

  • Perform chromatin immunoprecipitation (ChIP) assays to confirm binding of predicted transcription factors

  • Use reporter gene assays with various lengths of the putative promoter to identify key regulatory regions

  • Compare expression patterns across different tissues and developmental stages using qRT-PCR

How can KCNA10 knockout or knockdown models be generated in avian systems?

For chicken models, CRISPR-Cas9 gene editing represents the most promising approach for generating KCNA10 knockout lines. Target sites should be designed to disrupt early exons, similar to approaches used in mouse models . Alternative approaches include:

  • Morpholino-based knockdown in embryonic studies

  • Viral-mediated delivery of shRNA for tissue-specific knockdown

  • Dominant negative constructs that can interfere with channel assembly

Researchers should note that Kcna10-/- mice appear healthy and develop normally , suggesting that knockout chickens might be viable for studying channel function in development and adult physiology.

What is the role of KCNA10 in vestibular hair cells based on knockout studies?

Studies in mice have established that KV1.8 (KCNA10) plays an essential role in vestibular hair cell function. In type I hair cells, KCNA10 is necessary for the large low-voltage-activated conductance (gK,L) . In type II hair cells, KCNA10 is required for A-type and delayed rectifier conductances . These distinctive outward rectifiers produce different receptor potentials in type I and II hair cells, both involving KV1.8 and KV7 channels . Researchers studying chicken KCNA10 should investigate whether it plays similar roles in avian vestibular systems.

What behavioral consequences result from KCNA10 deletion?

Knockout studies in mice (Kcna10-/-) have revealed altered vestibular-ocular reflexes with different response dynamics at low frequencies and impaired performance on behavioral tests . This suggests KCNA10 plays a significant role in vestibular function that affects whole-animal behavior. Researchers working with chicken models should design comparable behavioral tests to assess vestibular function, balance, and motor coordination when manipulating KCNA10 expression.

How does KCNA10 contribute to cardiovascular physiology?

Given its expression in heart and aorta , KCNA10 may be involved in regulating vascular smooth muscle tone and cardiac action potentials. Researchers investigating chicken KCNA10 should design experiments to test:

  • The role of KCNA10 in cardiac electrophysiology using isolated cardiomyocyte recordings

  • Vascular reactivity in isolated vessel preparations with and without KCNA10 inhibitors

  • Blood pressure regulation in knockout or knockdown models

  • Compensatory changes in other ion channels following KCNA10 manipulation

How do the biophysical properties of KCNA10 compare across different species?

Understanding species differences is crucial for translating findings across models. The table below summarizes key electrophysiological properties of KCNA10/KV1.8 from available data:

ParameterHuman KCNA10Mouse KV1.8Predicted Chicken KCNA10
Half-activation voltage+3.5 ± 2.5 mV Varies by cell typeLikely between 0 and +10 mV
Single-channel conductance~11 pS Not fully characterizedExpected 8-12 pS
K+:Na+ selectivity≥15:1 Similar to humanExpected to maintain high K+ selectivity
InactivationMinimal Present in type II hair cells Likely minimal in most tissues

Researchers should systematically characterize chicken KCNA10 properties and compare them to mammalian homologs to understand evolutionary conservation and specialization.

What are the key differences in inhibitor sensitivity between KCNA10 and other KV channels?

KCNA10 exhibits an unusual pharmacological profile compared to typical KV channels:

Inhibitor ClassCompoundsEffect on KCNA10Effect on Typical KV1 Channels
Classical K+ channel blockersBarium, TEA, 4-APInhibition Inhibition
CNG channel inhibitorsVerapamil, pimozideInhibition Limited effect
PKC activatorsPhorbol esters (PMA)42% inhibition Variable effects

This distinctive pharmacological signature can be exploited to identify and isolate KCNA10 currents in complex native systems. Researchers working with chicken KCNA10 should verify whether these pharmacological properties are conserved across species.

How does KCNA10 interact with other potassium channel subunits?

Based on studies in mice, KV1.8 (KCNA10) likely forms heteromeric channels with other KV subunits, as suggested by the effects of gene dosage in heterozygous (Kcna10+/-) versus wildtype (Kcna10+/+) and knockout (Kcna10-/-) mice . In type II hair cells, Kcna10+/- specimens had smaller currents than Kcna10+/+ cells, reflecting a smaller delayed rectifier conductance and faster inactivation . This suggests different types of KV1.8 heteromers may form depending on the relative abundance of subunits. Researchers studying chicken KCNA10 should investigate potential heteromerization with other KV1 family members expressed in the same tissues.

What signaling pathways modulate KCNA10 function?

KCNA10 activity is regulated by protein kinase C (PKC), as demonstrated by the inhibitory effect of phorbol 12-myristate 13-acetate (PMA, a PKC activator) which reduced whole-cell current by 42% . This suggests that phosphorylation plays an important role in channel modulation. Researchers should investigate:

  • The specific phosphorylation sites on chicken KCNA10

  • Additional kinases that might regulate channel function

  • The effects of phosphatases on channel activity

  • The integration of KCNA10 into larger signaling networks within cells

How do membrane microdomains affect KCNA10 localization and function?

Ion channels, including potassium channels, often localize to specific membrane domains through interactions with scaffolding proteins and the cytoskeleton. For chicken KCNA10 research, investigators should consider:

  • The role of PDZ-binding motifs in channel clustering

  • Lipid raft associations that might influence channel function

  • Interactions with cytoskeletal elements that affect channel distribution

  • Co-localization with signaling molecules that modulate channel activity

What antibodies and molecular probes are available for chicken KCNA10 studies?

Due to the limited research on chicken KCNA10 specifically, researchers may need to develop custom tools. Strategies include:

  • Generating peptide antibodies against predicted extracellular or C-terminal regions

  • Testing cross-reactivity of existing mammalian KCNA10 antibodies

  • Developing epitope-tagged constructs for expression studies

  • Creating fluorescent protein fusion constructs for localization studies

Validation of these tools should include specificity tests in tissues from knockout or knockdown models.

What cell lines are suitable for stable expression of recombinant chicken KCNA10?

For stable expression systems, researchers should consider:

  • Avian cell lines (e.g., DF-1 chicken fibroblasts) for species-matched expression

  • Standard mammalian lines (HEK293, CHO) with proven track records for ion channel expression

  • Inducible expression systems to control the level and timing of channel expression

  • Co-expression with auxiliary subunits that might be required for proper trafficking or function

The choice should be guided by the specific research questions and downstream applications.

What human conditions might be modeled using KCNA10 manipulation in chicken systems?

Given KCNA10's expression in kidney, heart, and inner ear, research on chicken KCNA10 could provide insights into:

  • Vestibular disorders and balance problems

  • Cardiac arrhythmias, particularly those involving the action potential repolarization phase

  • Renal vascular disorders affecting blood pressure regulation

  • Potential roles in auditory function, given the expression in vestibular hair cells

The advantage of chicken models includes the accessibility of the embryo for developmental studies and the potential for organ-specific manipulations.

How might pharmacological targeting of KCNA10 be applied therapeutically?

Understanding KCNA10 function could lead to therapeutic applications. Researchers should consider:

  • Channel openers for enhancing deficient potassium currents

  • Selective blockers for conditions involving excessive channel activity

  • Modulators of channel trafficking for diseases involving mislocalization

  • Gene therapy approaches for genetic deficiencies

The unusual pharmacological profile of KCNA10, including sensitivity to both classical potassium channel blockers and CNG channel inhibitors , provides multiple potential targets for drug development.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.