Recombinant Chicken PRA1 family protein 3 (ARL6IP5)

Shipped with Ice Packs
In Stock

Description

Functional Roles and Interactions

ARL6IP5 is evolutionarily conserved, with roles inferred from mammalian and plant studies:

  • Glutamate Transport Modulation: In rats, ARL6IP5 binds and inhibits the glutamate transporter EAAC1 (SLC1A1), reducing glutamate uptake in a PKC-dependent manner . This suggests a regulatory role in neurotransmitter homeostasis.

  • Vitamin A Responsiveness: Expression is upregulated by retinoic acid, linking it to differentiation and cytoskeletal organization .

  • Membrane Trafficking: PRA1 proteins interact with prenylated Rab GTPases and SNAREs, potentially mediating vesicle fusion .

Table 2: Key Functional Interactions of ARL6IP5 Homologs

Interaction PartnerRole/FunctionSpecies
SLC1A1Inhibits glutamate transportRat
Rab GTPasesVesicle trafficking regulationPlant
Retinoic AcidUpregulates gene expressionRat

Research Applications

While chicken-specific studies are scarce, recombinant ARL6IP5 is used in:

  • Neurological Research: Investigating glutamate metabolism and oxidative stress responses .

  • Cancer Therapeutics: ARL6IP5 knockdown in ovarian cancer models reduces cisplatin resistance .

  • Vitamin A Signaling: Elucidating cytoskeletal dynamics in development .

Challenges and Limitations

  • Species-Specific Data: Most functional studies derive from mammals (e.g., rat, human) and plants . Direct evidence in avian systems remains sparse.

  • Structural Variability: The chicken protein’s secondary structure (e.g., transmembrane domains) requires experimental validation.

Future Directions

  1. Avian-Specific Studies: Characterizing the chicken ARL6IP5’s role in feather development or immune response.

  2. Therapeutic Targets: Exploring its potential in neuroprotection or cancer treatment.

  3. Evolutionary Insights: Comparing its function across species to identify conserved mechanisms.

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ARL6IP5; PRAF3; RCJMB04_3k9; PRA1 family protein 3; ADP-ribosylation factor-like protein 6-interacting protein 5; ARL-6-interacting protein 5; Aip-5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-188
Protein Length
full length protein
Species
Gallus gallus (Chicken)
Target Names
ARL6IP5
Target Protein Sequence
MEVQVAPLRSWEDFFPGSDRFGRPDFKDISKWNNRVVNNLLYYQTNYLMVAAAVVAIVGF LSPLNMLIGGTVVILVFLGFVWVSHNKDILRRMKKQYPTTFVIVIMLSSYFLISYLGDVM VFMFGITLPLLLMFIHASLRLRNIKNKLENKKEEIGLKKTPMGIILDALEQQEDNINKLA SYIPKVKE
Uniprot No.

Target Background

Function
This protein regulates intracellular taurine and glutamate concentrations. It negatively modulates SLC1A1/EAAC1 glutamate transport activity by reducing its glutamate affinity in a PKC activity-dependent manner. It may also be involved in membrane trafficking.
Database Links
Protein Families
PRA1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein. Cytoplasm. Cytoplasm, cytoskeleton.

Q&A

What is ARL6IP5 and what protein family does it belong to?

ARL6IP5 (ADP-ribosylation factor-like protein 6-interacting protein 5) belongs to the PRA1 (Prenylated Rab acceptor 1) family. Specifically, it is classified as PRA1 family protein 3 and contains a functionally large prenylated acceptor domain 1, which is primarily involved in intracellular protein trafficking . The protein is also known by several other names depending on the species: JWA in humans, Addicsin in mice, and GTRAP 3-18 or JM4 in rats . This protein plays important roles in various cellular processes, including autophagy regulation and protein trafficking.

What are the optimal conditions for expressing recombinant chicken ARL6IP5 in bacterial systems?

For optimal expression of recombinant chicken ARL6IP5 in bacterial systems, the following methodological approach is recommended:

  • Expression System Selection: E. coli is the preferred host for recombinant chicken ARL6IP5 expression due to its high yield and relative simplicity .

  • Vector Design: Incorporate an N-terminal His-tag for easier purification. The complete open reading frame (ORF) should be subcloned into an appropriate expression vector such as pET-32a(+) .

  • Induction Parameters: Based on comparative protein expression studies, induction with 0.1 mM IPTG at 28°C for approximately 5 hours yields optimal protein expression while maintaining solubility . This temperature represents a compromise between protein yield and proper folding.

  • Cell Lysis and Extraction: Gentle lysis methods are recommended to maintain protein integrity. PBS-based buffers with mild detergents are typically effective for extracting the protein from bacterial cells.

  • Purification Strategy: Ni-NTA His-Bind Resin affinity chromatography is the method of choice for purifying His-tagged ARL6IP5, followed by appropriate washing steps with transport buffer to remove non-specific binding proteins .

This approach yields functional protein suitable for downstream applications including interaction studies and functional assays.

How should recombinant ARL6IP5 be stored to maintain stability and activity?

To maintain optimal stability and activity of recombinant chicken ARL6IP5, the following storage protocol is recommended:

  • Short-term Storage: For working aliquots, store at 4°C for up to one week to minimize freeze-thaw cycles .

  • Long-term Storage: Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple use to prevent repeated freeze-thaw cycles, which can significantly reduce protein activity .

  • Storage Buffer: A Tris/PBS-based buffer with 6% Trehalose at pH 8.0 provides optimal stability during storage . Trehalose serves as a cryoprotectant that helps maintain protein structure during freezing.

  • Reconstitution: Prior to use, briefly centrifuge the vial to bring contents to the bottom. Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

  • Glycerol Addition: Addition of 5-50% glycerol (final concentration) is recommended before aliquoting for long-term storage at -20°C/-80°C. A 50% final concentration of glycerol is standard practice .

These storage conditions help maintain the structural integrity and functional activity of the protein for extended periods while minimizing degradation.

What methods are most effective for studying ARL6IP5 protein-protein interactions?

For studying ARL6IP5 protein-protein interactions, multiple complementary approaches should be employed to ensure robust results:

  • Co-immunoprecipitation (Co-IP): This method is effective for detecting protein interactions in cellular contexts. The protocol involves:

    • Transfection of cells with tagged ARL6IP5 constructs (e.g., HA-tagged)

    • Cell lysis with appropriate IP lysis buffer

    • Incubation with specific antibodies (anti-HA) overnight at 4°C

    • Recovery of immune complexes using protein A+G Agarose

    • Analysis by Western blotting

  • Pull-down Assays: For direct protein interaction verification:

    • Express His-tagged ARL6IP5 and GST-tagged potential interacting protein separately in E. coli BL21(DE3)

    • Purify using Ni-NTA His-Bind Resin and Glutathione-Sepharose 4B beads, respectively

    • Incubate His-Bind Resin-bound ARL6IP5 with purified GST-tagged protein

    • Wash and analyze by SDS-PAGE and Western blotting

  • Mass Spectrometry Analysis: For unbiased identification of interacting partners:

    • Perform Co-IP as described above

    • Analyze immunoprecipitates by LC-MS/MS

    • Process data using MS matching software (e.g., MASCOT)

    • Filter results by excluding proteins present in control groups

    • Verify interactions using directed methods

  • Bioinformatics Analysis:

    • Perform GO annotation of identified proteins using UniProt

    • Analyze KEGG pathways using the KEGG PATHWAY database

    • Create protein-protein interaction networks using tools like STRING

This multi-modal approach provides comprehensive characterization of ARL6IP5 interactions, revealing its functional roles within cellular networks.

What are the known protein interaction partners of ARL6IP5 and their functional significance?

Research has identified several key interaction partners of ARL6IP5, each with distinct functional implications:

  • ATG12: ARL6IP5 has been identified as an ATG12 interacting protein. This interaction is significant as ATG12 is a critical component of the autophagy machinery, suggesting that ARL6IP5 may directly influence autophagy through this interaction .

  • Rab1: The ARL6IP5/Rab1/ATG12 axis has been implicated in neuroprotection in Parkinson's disease models. This interaction appears to be crucial for the autophagy-inducing effects of ARL6IP5 .

  • EAAC1 Transporter: ARL6IP5 functions as a negative regulator of the EAAC1 transporter, potentially influencing glutamate transport and neuronal excitability .

  • α-Synuclein: While not necessarily a direct binding partner, ARL6IP5 significantly impacts α-synuclein aggregation. ARL6IP5 overexpression reduces α-synuclein aggregate burden and improves cell survival in A53T models of Parkinson's disease .

These interactions position ARL6IP5 at the intersection of multiple cellular pathways, particularly those related to protein trafficking, autophagy regulation, and neuroprotection. The protein appears to function as a hub connecting these processes, especially in the context of neurodegenerative conditions.

How does ARL6IP5 influence autophagy in the context of neurodegenerative diseases?

ARL6IP5 functions as a novel regulator and inducer of neuronal autophagy, with significant implications for neurodegenerative diseases:

  • Autophagy Induction Mechanism: ARL6IP5 has been identified as an autophagy inducer that operates through the ARL6IP5/Rab1/ATG12 axis . By interacting with ATG12, a key autophagy-related protein, ARL6IP5 directly influences the autophagy machinery.

  • Age-Related Expression Changes: Research has revealed that ARL6IP5 levels decrease in the brain with age and in Parkinson's disease in both mice and humans . This age-dependent decline may contribute to reduced autophagy capacity and increased susceptibility to protein aggregation diseases.

  • Response to Pathological Conditions: In cellular models of Parkinson's disease, both wild-type and A53T mutant α-synuclein overexpression result in decreased levels of ARL6IP5. Specifically, there is a significant reduction (60 ± 25%, p < 0.0001) in ARL6IP5 levels in cells overexpressing A53T mutant α-synuclein compared to control cells .

  • Therapeutic Potential: Experimental evidence indicates that ARL6IP5 overexpression can reduce α-synuclein aggregate burden. In SH-SY5Y cells stably expressing mutant GFP-A53T α-synuclein, ARL6IP5 transfection led to a significant decrease in A53T-α-synuclein fluorescence (from 58 ± 24 in control cells to 28 ± 33 in ARL6IP5 transfected cells, p < 0.0001) .

These findings establish ARL6IP5 as a critical regulator of neuronal autophagy that could potentially be targeted for therapeutic interventions in neurodegenerative diseases characterized by protein aggregation.

What is the effect of ARL6IP5 modulation on α-synuclein aggregation in Parkinson's disease models?

ARL6IP5 demonstrates significant effects on α-synuclein aggregation and cellular survival in Parkinson's disease models:

  • Reduction of α-Synuclein Aggregates: Overexpression of ARL6IP5 in cellular models of Parkinson's disease (PD) leads to a measurable decrease in α-synuclein aggregation. In SH-SY5Y cells expressing GFP-A53T α-synuclein, ARL6IP5 transfection reduced the level of A53T-α-synuclein fluorescence by approximately 52% (from 58 ± 24 in control cells to 28 ± 33 in ARL6IP5 transfected cells, p < 0.0001) .

  • Cytoprotective Effects: ARL6IP5 overexpression improves cell survival in A53T models of Parkinson's disease . This protective effect appears to be mediated through enhanced autophagy, which facilitates the clearance of toxic protein aggregates.

  • Loss-of-Function Effects: Conversely, siRNA-mediated knockdown of ARL6IP5 in cellular PD models exacerbates toxicity. LDH assay results showed that α-synuclein overexpression in the knockdown condition of ARL6IP5 produces significantly more toxicity (15 ± 7%, p = 0.018) than α-synuclein overexpression alone .

  • Relationship to Disease Progression: The natural decline of ARL6IP5 levels observed in aging and PD may contribute to disease progression by reducing the cellular capacity to clear protein aggregates through autophagy .

This evidence suggests that ARL6IP5 may represent a promising therapeutic target for PD and potentially other neurodegenerative diseases characterized by protein aggregation. Strategies to maintain or increase ARL6IP5 levels could enhance neuronal autophagy and reduce toxic protein burden.

What are the critical quality control parameters for validating recombinant ARL6IP5 protein preparation?

To ensure the quality and functionality of recombinant chicken ARL6IP5 preparations, researchers should implement the following critical quality control parameters:

  • Purity Assessment:

    • SDS-PAGE analysis should confirm purity greater than 90%

    • Absence of degradation products or contaminant bands

    • Verification of expected molecular weight (approximately 21 kDa plus tag contribution)

  • Protein Integrity:

    • Western blot analysis using specific antibodies against ARL6IP5 or the affinity tag

    • Mass spectrometry confirmation of protein identity and sequence coverage

    • Circular dichroism (CD) spectroscopy to verify proper secondary structure

  • Functional Validation:

    • Binding assays with known interaction partners (e.g., ATG12)

    • Confirmation of expected cellular localization using fluorescently tagged constructs

    • Autophagy induction assays to verify biological activity

  • Solubility and Stability:

    • Monitoring protein solubility during storage and after reconstitution

    • Thermal shift assays to assess protein stability

    • Limited proteolysis to evaluate proper folding and domain organization

  • Endotoxin Testing:

    • For applications involving cell culture, endotoxin levels should be assessed

    • Limulus Amebocyte Lysate (LAL) assay can determine endotoxin contamination

    • Endotoxin levels should be <1.0 EU/μg of protein for cell-based experiments

Implementation of these quality control measures ensures that experimental outcomes reflect the true biological properties of ARL6IP5 rather than artifacts resulting from poor protein quality.

How can researchers design experiments to investigate the dual role of ARL6IP5 in protein trafficking and autophagy?

To effectively investigate the dual functionality of ARL6IP5 in protein trafficking and autophagy, researchers should consider the following experimental design strategies:

  • Domain Mapping and Mutation Analysis:

    • Generate truncated versions of ARL6IP5 to identify domains responsible for trafficking versus autophagy functions

    • Introduce point mutations in conserved residues to selectively disrupt specific functions

    • Create chimeric proteins by swapping domains with related PRAF family proteins to determine domain-specific activities

  • Cellular Localization Studies:

    • Employ high-resolution confocal microscopy with fluorescently tagged ARL6IP5 constructs

    • Perform co-localization studies with organelle markers for ER, Golgi, endosomes, and autophagosomes

    • Use live-cell imaging to track ARL6IP5 movement during autophagy induction and protein trafficking events

  • Functional Assays:

    • For Protein Trafficking:

      • Measure transport rates of known cargo proteins in the presence or absence of ARL6IP5

      • Assess EAAC1 transporter activity using glutamate uptake assays

      • Analyze the impact of ARL6IP5 on Rab GTPase activity and localization

    • For Autophagy:

      • Quantify LC3-I to LC3-II conversion by Western blotting

      • Monitor autophagic flux using tandem fluorescent-tagged LC3 (tfLC3) reporters

      • Measure clearance of aggregation-prone proteins like α-synuclein

  • Differential Interactome Analysis:

    • Perform IP-MS studies under conditions that preferentially activate either trafficking or autophagy

    • Compare interactomes to identify protein partners unique to each function

    • Validate key interactions using techniques described in section 3.1

  • Rescue Experiments:

    • Design complementation assays where ARL6IP5 mutants are expressed in ARL6IP5-depleted cells

    • Determine which mutants can rescue trafficking defects versus autophagy defects

    • Use this approach to establish whether these functions can be genetically separated

This comprehensive experimental approach will help delineate the molecular mechanisms by which ARL6IP5 contributes to both protein trafficking and autophagy regulation, potentially revealing how these functions are coordinated or independently regulated.

What are common challenges in recombinant ARL6IP5 expression and purification, and how can they be addressed?

Researchers frequently encounter several challenges when working with recombinant ARL6IP5. Here are the most common issues and recommended solutions:

ChallengePossible CausesSolutions
Poor protein expressionCodon bias in E. coliUse codon-optimized sequence or specialized E. coli strains (e.g., Rosetta)
Toxicity to host cellsReduce IPTG concentration (0.05-0.1 mM), lower induction temperature (16-28°C)
Protein instabilityAdd protease inhibitors during lysis, reduce induction time
Protein insolubilityImproper foldingExpress at lower temperatures (16-28°C) instead of 37°C
Hydrophobic domains causing aggregationAdd mild detergents or solubilizing agents to lysis buffer
Excessive expression rateReduce IPTG concentration and expression time
Low purification yieldInsufficient binding to affinity resinOptimize imidazole concentration in binding and wash buffers
Protein degradationInclude protease inhibitors in all buffers, work at 4°C
Poor elutionAdjust pH or imidazole gradient during elution
Protein degradationProtease contaminationAdd additional protease inhibitors, purify rapidly at 4°C
Intrinsic instabilityAdd stabilizers like glycerol (5-10%) or trehalose (6%)
Loss of activityImproper foldingRefold protein using gradual dialysis if necessary
Critical cofactors missingSupplement with potential cofactors during activity assays
Oxidation of cysteine residuesAdd reducing agents like DTT or β-mercaptoethanol

Implementation of these troubleshooting strategies should significantly improve recombinant ARL6IP5 production for research applications.

How can researchers optimize assays to detect and measure ARL6IP5-mediated autophagy induction?

To effectively detect and quantify ARL6IP5-mediated autophagy induction, researchers should consider the following optimized methodological approaches:

  • LC3 Conversion Assay Optimization:

    • Use Western blotting to monitor LC3-I to LC3-II conversion

    • Include bafilomycin A1 controls to block autophagosome-lysosome fusion for measuring autophagic flux

    • Compare samples with and without ARL6IP5 overexpression or knockdown

    • Normalization: Use stable housekeeping proteins (β-actin, GAPDH) for accurate quantification

  • Fluorescence-Based Autophagy Detection:

    • Employ cells stably expressing GFP-LC3 or tandem mRFP-GFP-LC3

    • Optimize image acquisition parameters: use consistent exposure times and microscope settings

    • Quantification methodology: count LC3-positive puncta per cell across multiple fields (>100 cells)

    • Establish clear thresholds for defining autophagy induction (e.g., >5 puncta per cell)

  • α-Synuclein Clearance Assay:

    • Use SH-SY5Y cells stably expressing A53T mutant α-synuclein as a model system

    • Measure α-synuclein levels via fluorescence intensity or Western blotting

    • Include positive controls (known autophagy inducers like rapamycin)

    • Time-course analysis: monitor clearance at 24, 48, and 72 hours post-treatment

  • Biochemical Autophagy Flux Measurement:

    • Monitor degradation of long-lived proteins using radiolabeled amino acids

    • Implement pulse-chase protocols with appropriate chase periods (4-24 hours)

    • Include autophagy inhibitors (3-methyladenine, wortmannin) as negative controls

    • Calculate degradation rates with and without ARL6IP5 manipulation

  • Transmission Electron Microscopy (TEM):

    • The gold standard for autophagosome visualization

    • Optimize fixation and staining protocols for autophagosome preservation

    • Quantify autophagic vacuoles per cell area across multiple sections

    • Distinguish between autophagosomes (double-membrane) and autolysosomes (single-membrane)

  • Molecular Interaction Analysis:

    • Investigate ARL6IP5 interaction with ATG12 under different conditions

    • Optimize Co-IP protocols for detecting transient interactions

    • Use proximity ligation assays to visualize interactions in situ

    • Measure interaction dynamics in response to autophagy triggers

These optimized approaches provide a comprehensive toolkit for accurately measuring and characterizing ARL6IP5-mediated autophagy induction across different experimental contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.