Recombinant Chicken Protein Asterix (WDR83OS)

Shipped with Ice Packs
In Stock

Description

Protein Overview and Functional Role

Recombinant Chicken Protein Asterix (WDR83OS) is a 101-amino acid transmembrane protein encoded by the WDR83OS gene. It is part of the PAT complex, which facilitates the insertion of multi-pass transmembrane domain (TMD) proteins into the endoplasmic reticulum (ER) membrane . Key features include:

  • UniProt ID: F8RT80

  • Molecular Weight: ~10 kDa

  • Expression Region: Full-length (1–101 aa)

  • Tag: N-terminal 10xHis-tag

Functional Interactions:

ComponentRole in PAT ComplexEvidence Source
CCDC47Single-pass membrane protein; stabilizes PAT complex
Asterix (WDR83OS)Engages hydrophilic TMDs via three transmembrane domains
ER TransloconMediates nascent chain integration into lipid bilayer

The PAT complex acts as an intramembrane chaperone, binding TMDs with exposed hydrophilic residues and releasing them upon proper folding . Mutations in WDR83OS are linked to neurodevelopmental disorders and familial hypercholanemia .

Production and Purification

The recombinant protein is produced via in vitro E. coli expression systems, with optimized protocols for high yield and purity:

ParameterSpecificationSource
Expression HostE. coli
Purity>90% (SDS-PAGE confirmed)
Storage BufferTris/PBS-based buffer, 6% trehalose, pH 8.0
Stability6 months (liquid, -20°C/-80°C); 12 months (lyophilized, -20°C/-80°C)

Key Considerations:

  • Freezing/Thawing: Avoid repeated cycles; working aliquots stored at 4°C for ≤1 week .

  • Reconstitution: Suspend in deionized sterile water (0.1–1.0 mg/mL) with 5–50% glycerol for long-term storage .

Membrane Protein Biogenesis

Asterix interacts with diverse TMDs (e.g., rhodopsin, CHRM1) during ER insertion. Studies using photo-crosslinking revealed:

  • Substrate Specificity: Binds TMDs with polar/hydrophilic residues (e.g., asparagine in TMD1) .

  • Chaperone Mechanism: Releases substrates upon proper folding, enabling efficient membrane protein assembly .

Neurodevelopmental and Metabolic Disorders

WDR83OS mutations are implicated in:

  • Neurodevelopmental Disorder with Hypercholanemia: Linked to impaired bile acid metabolism and neurological deficits .

  • ER Stress Pathways: Dysregulation may contribute to cellular stress responses .

Comparative Analysis of Production Systems

While E. coli remains the primary host for Asterix production, emerging systems (e.g., avian oviduct bioreactors) are being explored for therapeutic proteins. Key advantages/disadvantages:

SystemAdvantagesLimitationsSource
E. coliHigh yield, cost-effective, rapid scalingLimited post-translational modifications
Avian OviductTissue-specific expression, human-like glycosylationLow germline transmission efficiency; off-target CRISPR risks

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, kindly indicate your requirement when placing your order. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. For precise delivery times, please consult your local distributors.
Note: All our proteins are shipped standard with blue ice packs. Should you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. We advise storing working aliquots at 4°C for a maximum of one week.
Reconstitution
For optimal reconstitution, we recommend centrifuging the vial briefly prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration ranging from 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference for your use.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life for the liquid form is 6 months at -20°C/-80°C. The lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
WDR83OS; PAT complex subunit Asterix; Protein WDR83OS homolog; Protein associated with the ER translocon of 10kDa; PAT-10; PAT10
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Gallus gallus (Chicken)
Target Names
WDR83OS
Target Protein Sequence
MADPRRPARVTRYKPPTTESNPALEDPTPDYMNLLGMVFSMCGLMLKLKWCAWIAVYCSF ISFANSRSSEDTKQMMSSFMLSISAVVMSYLQNPQPMSPPW
Uniprot No.

Target Background

Function
Asterix (WDR83OS) is a component of the PAT complex, an endoplasmic reticulum (ER)-resident membrane multiprotein complex. This complex plays a crucial role in facilitating the insertion of multi-pass membrane proteins into membranes. The PAT complex functions as an intramembrane chaperone by directly interacting with nascent transmembrane domains (TMDs). It releases its substrates upon correct folding, ensuring optimal biogenesis of multi-pass membrane proteins. WDR83OS/Asterix, the substrate-interacting subunit of the PAT complex, requires CCDC47 for stability. WDR83OS/Asterix associates with the first transmembrane domain (TMD1) of the nascent chain, independent of N-glycosylation and the amino acid sequence or transmembrane topology of TMD1. The PAT complex exhibits a preference for binding to TMDs with exposed hydrophilic amino acids within the lipid bilayer, creating a membrane-embedded partially hydrophilic environment that promotes TMD1 binding.
Database Links
Protein Families
Asterix family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

How does Chicken Protein Asterix compare to mammalian orthologs?

The chicken Asterix protein (101 amino acids) is slightly shorter than its human counterpart (106 amino acids) . WDR83OS is highly conserved across species, with orthologs identified in humans, chimpanzees, mice, rats, bovine, canine, frog, zebrafish, and even invertebrates like Drosophila melanogaster and Caenorhabditis elegans . This conservation suggests that Asterix performs fundamental cellular functions that have been preserved throughout animal evolution.

Despite variations in length, the functional domains appear to be conserved, particularly given its consistent role in the PAT complex across species. The specific differences in functional properties between chicken and mammalian Asterix require further comparative biochemical analysis.

What methodologies are appropriate for studying Asterix in developmental contexts?

Based on research involving Asterix/WDR83OS, several approaches are effective:

  • Animal models: Zebrafish models lacking Wdr83os function have successfully demonstrated its role in the nervous system, craniofacial development, and lipid absorption .

  • Genetic analysis: Family-based rare variant analyses using exome sequencing (ES) has been effective for identifying biallelic variants and correlating them with phenotypes .

  • Longitudinal studies: Tracking developmental parameters (such as head circumference) over time has revealed progressive changes associated with WDR83OS mutations .

  • Biochemical profiling: Measuring bile acids, bilirubin, and liver enzymes has helped characterize the phenotypic effects of WDR83OS variants .

What expression systems are optimal for producing functional Recombinant Chicken Protein Asterix?

The most validated expression system for Recombinant Chicken Protein Asterix is E. coli with an N-terminal His tag . This system has successfully produced the full-length protein (amino acids 1-101) with purity greater than 90% as determined by SDS-PAGE .

The expression construct typically contains:

  • Complete coding sequence (amino acids 1-101)

  • N-terminal His tag for purification

  • Appropriate bacterial promoter system

When designing expression constructs, researchers should consider:

  • Codon optimization for E. coli

  • Inclusion of protease cleavage sites if tag removal is desired

  • Vector compatibility with high-density bacterial culture

For applications requiring post-translational modifications, alternative expression systems such as insect cells or mammalian cells might be worth exploring, though these haven't been documented in the available literature for chicken Asterix specifically.

What are the optimal reconstitution and storage conditions for Recombinant Chicken Protein Asterix?

For reconstitution:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to 5-50% final concentration (recommended: 50%)

  • Aliquot for long-term storage

Storage conditions:

  • Store lyophilized powder at -20°C/-80°C upon receipt

  • Store reconstituted aliquots at -20°C/-80°C for long-term storage

  • Working aliquots can be maintained at 4°C for up to one week

  • Avoid repeated freeze-thaw cycles

The protein is typically supplied in Tris/PBS-based buffer with 6% Trehalose at pH 8.0 , suggesting these conditions are optimal for stability.

How can researchers validate the structure and function of recombinant Asterix protein?

While the search results don't provide specific assays for Chicken Protein Asterix, several approaches would be appropriate based on its known function:

  • Structural validation:

    • SDS-PAGE to confirm molecular weight (~12 kDa plus tag size)

    • Western blotting using anti-His tag or specific anti-Asterix antibodies

    • Circular dichroism to assess secondary structure

  • Functional validation:

    • Co-immunoprecipitation with CCDC47 (its partner in the PAT complex)

    • In vitro binding assays with known interaction partners

    • Complementation studies in cells with WDR83OS knockdown

  • Activity assessment:

    • Protein folding assistance assays using model transmembrane proteins

    • Cell-based assays measuring membrane protein insertion efficiency

What human diseases are associated with WDR83OS mutations and how does this inform chicken Asterix research?

Homozygous variants in WDR83OS are associated with a neurodevelopmental syndrome characterized by:

  • Neurodevelopmental disorder (14/14 affected individuals)

  • Facial dysmorphism (13/14)

  • Intractable itching (9/14)

  • Elevated bile acids (5/6 tested)

Additional features include:

  • Normal to mildly elevated liver enzymes

  • Normal bilirubin levels

  • Progressive reduction in relative head circumference in some cases

These findings highlight the importance of WDR83OS in:

  • Neural development and function

  • Craniofacial development

  • Bile acid metabolism

Chicken Asterix research can provide valuable insights into these processes through comparative studies, especially given the conservation of this protein across species. Using chicken as a model system might be particularly valuable for studying developmental aspects of Asterix function.

How can zebrafish models contribute to understanding Asterix function in comparison to chicken models?

Zebrafish models lacking Wdr83os function have successfully demonstrated its role in:

  • Nervous system development

  • Craniofacial formation

  • Lipid absorption

These phenotypes align with the human disease manifestations, confirming the evolutionary conservation of Asterix function.

For comparative studies, researchers should consider:

  • Zebrafish models are advantageous for high-throughput screening and real-time visualization of developmental processes

  • Chicken models offer closer evolutionary relationship to mammals and more complex developmental processes

  • Combining findings from both models can provide complementary insights into Asterix function

What technical considerations are important when analyzing Asterix function in protein folding pathways?

When studying Asterix's role in protein folding:

  • Substrate selection: Focus on large proteins with multiple transmembrane domains, as these are the primary clients of the PAT complex .

  • Cellular context: Consider the endoplasmic reticulum environment where Asterix naturally functions.

  • Complex formation: Always consider the interaction with CCDC47, as Asterix functions as part of the PAT complex rather than in isolation .

  • Detection methods: Use techniques sensitive enough to capture the potentially transient interactions during protein folding.

  • Specificity controls: Include experiments with known non-substrate proteins to demonstrate the specificity of Asterix's chaperone function.

  • Stress conditions: Test function under various cellular stresses that might affect protein folding (e.g., heat shock, reducing agents).

How can structural studies of Chicken Protein Asterix inform drug development for WDR83OS-related disorders?

While current search results don't detail structural studies of Chicken Protein Asterix, such research could potentially:

  • Identify critical binding interfaces between Asterix and CCDC47 that could be targeted with small molecules to modulate PAT complex function.

  • Reveal substrate-binding regions that could be exploited to enhance or restore chaperone activity in disease variants.

  • Provide templates for in silico screening of compounds that might stabilize mutant Asterix proteins.

  • Help design peptide mimetics that could substitute for dysfunctional protein domains.

Notably, the human disease phenotypes associated with WDR83OS variants suggest that enhancing Asterix function could potentially address neurodevelopmental issues and bile acid metabolism abnormalities .

What are the limitations of current antibodies for Chicken Protein Asterix research?

  • Cross-reactivity: Verify whether antibodies raised against human or mammalian Asterix effectively recognize the chicken ortholog, given the differences in amino acid sequence.

  • Epitope accessibility: Determine if antibodies can detect Asterix in its native conformation within the PAT complex or only when denatured.

  • Application range: Validate antibodies for specific applications (Western blotting, immunoprecipitation, immunofluorescence, etc.).

  • Batch variability: Monitor consistency between antibody batches, especially for polyclonal antibodies.

  • Background in chicken tissues: Test for non-specific binding in chicken-derived samples.

How do recent advances in genetic studies inform approaches to studying Asterix function in chickens?

Recent genetic studies revealing WDR83OS's role in human disease suggest several approaches for chicken research:

  • CRISPR/Cas9 genome editing: Generate chicken cell lines or embryos with specific mutations mirroring those found in human patients.

  • Conditional knockouts: Develop systems to study temporal and tissue-specific requirements for Asterix during development.

  • Reporter systems: Create fusion proteins or reporters to track Asterix localization and dynamics in chicken cells.

  • Transcriptomics: Compare gene expression changes between wild-type and Asterix-deficient chicken cells to identify downstream pathways.

  • Interactome studies: Use proteomics approaches to identify chicken-specific interaction partners that might reveal species-specific functions.

These approaches could reveal both conserved and divergent aspects of Asterix function between chickens and mammals, potentially identifying new therapeutic targets for WDR83OS-related disorders.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.