Recombinant Chicken Protein CNPPD1 (CNPPD1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment based on availability.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its implementation during production.
Synonyms
CNPPD1; RCJMB04_3a20; Protein CNPPD1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-439
Protein Length
full length protein
Species
Gallus gallus (Chicken)
Target Names
CNPPD1
Target Protein Sequence
MDLNGFLLDEEGAFSLSGFQEFTFLPRHQQLSERVRKRLYYGWDKECTLDNLSSPVADIA VELLQKVAPSPIRRLQKKYVSHVSREACISPCSMMLALVYIERLRHRNPEYLQQISSSDL FLISMMVASKYLYDEGEEEEVFNDEWGAAGKVDVQTMNTLEMNFLSAIDWSLYTDPRELF EVLSWLEGRVAEKQGMWRGWFTYTDLCVLMEQSMWQQALGHFYQQVVKLACLLGVVYLTG FAAVFTSIAVVHRAVCTRSTSITALRPALIPVESGCQLGAQPALAPEQPQPKLPDVSPPS STHCLGENETAEELRRGGVTATALYLWGSVMTALSYVKAPDIALHKSPLQAPLRKVPTAC ERSNRTAPVTAPNQPGPFGLAVLLAPPALHCHTCSAAARPTWDATPNHRKDWLDPLGLRQ CFLHAALDLGRIKSFIFPS
Uniprot No.

Target Background

Database Links

KEGG: gga:424204

UniGene: Gga.2905

Protein Families
CNPPD1 family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What expression systems are commonly used for producing recombinant chicken CNPPD1?

E. coli expression systems are frequently used for producing recombinant chicken CNPPD1. Commercial preparations typically use bacterial expression systems like E. coli BL21 strains, which allow for high-yield production of recombinant proteins . The bacterial expression approach has been successfully employed for other chicken recombinant proteins such as adiponectin, where the full-length gene was amplified by PCR, cloned into vector pET-32a, and transformed into E. coli BL21 .

For CNPPD1 specifically, expression typically involves:

  • Cloning the full-length chicken CNPPD1 gene into a suitable expression vector

  • Incorporating tags (such as His-tag) for purification purposes

  • Transforming into competent E. coli cells

  • Inducing expression using IPTG at optimized temperatures (typically 30-37°C)

While E. coli is most common, mammalian or insect cell expression systems may be preferred for studies requiring post-translational modifications that bacterial systems cannot provide.

How should recombinant CNPPD1 be stored for maximum stability?

For optimal stability of recombinant CNPPD1, follow these evidence-based storage guidelines:

  • Long-term storage: Store at -20°C or preferably -80°C upon receipt

  • Aliquoting: Divide into single-use aliquots to avoid repeated freeze-thaw cycles

  • Working stocks: Short-term storage of working aliquots can be maintained at 4°C for up to one week

  • Storage buffer: Typically preserved in Tris/PBS-based buffer with 6% trehalose at pH 8.0

  • Glycerol addition: Adding glycerol to a final concentration of 5-50% (commonly 50%) helps prevent freeze-thaw damage

It is strongly recommended to avoid repeated freeze-thaw cycles as they significantly decrease protein activity. Research has shown that proteins like CNPPD1 maintain better stability when stored as aliquots in buffers containing cryoprotectants like trehalose or glycerol.

What reconstitution procedures are recommended for lyophilized CNPPD1?

To properly reconstitute lyophilized CNPPD1 for experimental use, follow this methodological approach:

  • Centrifuge the vial briefly (pulse spin) to bring all content to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • For long-term storage after reconstitution, add glycerol to a final concentration of 5-50% (typically 50%)

  • Aliquot the reconstituted protein into single-use volumes

  • Store aliquots at -20°C or -80°C

When planning experiments, consider that the buffer components (Tris/PBS with 6% trehalose, pH 8.0) may affect certain assays, especially those sensitive to pH or buffer composition. In such cases, buffer exchange using dialysis or desalting columns may be necessary prior to experimental use.

How can I validate the purity and activity of recombinant CNPPD1?

Validation of recombinant CNPPD1 should employ multiple complementary approaches:

Purity Assessment:

  • SDS-PAGE analysis: Commercial CNPPD1 typically shows >90% purity by SDS-PAGE

  • Western blotting: Use anti-His antibodies for tagged versions or specific anti-CNPPD1 antibodies

  • Mass spectrometry: For precise molecular weight confirmation and detection of potential contaminants

Activity Validation:

  • Functional assays: Design based on predicted biological activity (similar to approaches used for other chicken recombinant proteins like MERTK's assessment for signal pathway activation)

  • Binding assays: If interaction partners are known

  • Phosphorylation status analysis: If CNPPD1 is involved in signaling pathways similar to other chicken RTKs

Since specific CNPPD1 activity assays are not well-established in the literature, researchers often need to develop custom validation assays based on predicted functions or homology with better-characterized proteins.

What detection methods are most effective for identifying CNPPD1 in experimental systems?

For optimal detection of recombinant CNPPD1 in various experimental contexts:

Antibody-based methods:

  • Western blotting: Primary detection method using anti-His antibodies (for His-tagged versions) or specific anti-CNPPD1 antibodies

  • Immunofluorescence: For cellular localization studies

  • ELISA: For quantitative measurement in solution

Tag-based detection:

  • His-tag detection: Using anti-His antibodies or Ni-NTA conjugated fluorophores

  • Other fusion tags: If the recombinant protein contains additional tags like FLAG or GST

Mass spectrometry approaches:

  • LC-MS/MS: For identification in complex samples

  • MALDI-TOF: For molecular weight confirmation

When designing detection experiments, consider including positive controls and calibration standards for quantitative analyses. The detection limit and specificity vary between methods, so method selection should align with experimental objectives.

What functional roles has CNPPD1 been associated with in chicken biology?

Research on chicken CNPPD1's specific functions remains limited, but insights can be drawn from homologous proteins and preliminary studies:

While direct studies on chicken CNPPD1 function are sparse in the current literature, related chicken receptor tyrosine kinases like MERTK have been shown to participate in immune response regulation. For example, chicken MERTK (chMertk) has been demonstrated to heighten STAT1 phosphorylation in the type I IFN signal pathway and suppress Newcastle disease virus replication through IFITM3 .

By inference and homology, CNPPD1 may potentially be involved in:

  • Cell signaling pathways

  • Neural development processes (suggested by its name)

  • Immune response modulation (similar to other chicken regulatory proteins)

Further direct functional studies are needed to elucidate CNPPD1's precise biological roles in chicken physiology.

What are the key challenges in expressing full-length CNPPD1 compared to truncated versions?

Expression of full-length CNPPD1 presents several technical challenges compared to truncated versions:

  • Solubility issues: Larger proteins like full-length CNPPD1 (439 amino acids) often exhibit lower solubility in bacterial expression systems, potentially leading to inclusion body formation.

  • Conformational integrity: Maintaining proper folding of the entire 439-amino acid sequence is more challenging than with shorter fragments, potentially affecting functional activity.

  • Expression efficiency: Full-length proteins typically express at lower yields compared to truncated versions, requiring optimization of induction conditions (temperature, IPTG concentration, duration).

  • Purification complexity: Complete purification of full-length CNPPD1 may require more sophisticated approaches beyond simple affinity chromatography.

Based on experience with other recombinant chicken proteins, optimization strategies include:

  • Lowering induction temperature (30°C instead of 37°C)

  • Using specialized E. coli strains designed for expressing difficult proteins

  • Adding solubility-enhancing fusion partners like thioredoxin (as seen with chicken adiponectin )

  • Optimizing induction time and IPTG concentration

What controls should be included when using recombinant CNPPD1 in experiments?

Robust experimental design with recombinant CNPPD1 requires appropriate controls:

Negative controls:

  • Buffer-only treatments (reconstitution buffer without protein)

  • Irrelevant protein control (another recombinant protein with similar tags and purification method)

  • Heat-inactivated CNPPD1 (for enzyme activity studies)

Positive controls:

  • Commercially validated functional proteins in the same pathway (if known)

  • Native CNPPD1 extract (if available)

  • Previously validated batch of recombinant CNPPD1

Experimental validation controls:

  • Dose-response analyses to confirm specific activity

  • Time-course studies to establish optimal treatment duration

  • Tag-only controls if using tagged CNPPD1 to rule out tag-mediated effects

As seen with other chicken recombinant proteins like MERTK, inclusion of pathway-specific controls (such as IFN-I treatment when studying antiviral effects) provides valuable comparison points .

How can I optimize experimental conditions when using recombinant CNPPD1 in cell culture?

For optimal use of recombinant CNPPD1 in cell culture experiments:

Cell type selection:

  • Use cell lines derived from relevant chicken tissues (such as DF-1 fibroblasts or LMH hepatocellular carcinoma cells)

  • Consider primary chicken cells for physiologically relevant conditions

Treatment parameters:

  • Concentration range: Typically 10-1000 ng/mL, but requires titration for each specific application

  • Treatment duration: Establish time-course from 3-48 hours to determine optimal exposure time

  • Culture conditions: Standard conditions (37°C, 5% CO₂) for chicken cell lines

Delivery optimization:

  • Serum considerations: Serum proteins may interfere with recombinant protein activity; consider serum-free or reduced-serum conditions

  • Carrier proteins: Addition of BSA (0.1-1%) may enhance stability

  • Transfection vs. addition: Direct addition to media or transfection of encoding plasmid (similar to methods used for chMertk )

Assessment methods:

  • Monitor specific cellular responses at multiple timepoints (3, 6, 9, 12 hours as used in chMertk studies )

  • Use multiple complementary assays to validate observations

ParameterRecommended RangeNotes
Protein concentration10-1000 ng/mLTitrate for specific application
Treatment duration3-48 hoursEstablish time-course
Temperature37°CStandard for avian cells
Cell confluence70-80%For optimal uptake/response
MediumCell-specificLow-serum during treatment

What approaches can be used to study protein-protein interactions involving CNPPD1?

To investigate CNPPD1 protein interactions, consider these methodological approaches:

In vitro methods:

  • Co-immunoprecipitation (Co-IP): Using antibodies against CNPPD1 or its tag to pull down potential interaction partners

  • Pull-down assays: Using purified recombinant CNPPD1 as bait

  • Surface Plasmon Resonance (SPR): For measuring binding kinetics with purified potential partners

  • Protein microarrays: For screening multiple potential interactions simultaneously

Cellular methods:

  • Proximity ligation assay (PLA): For detecting protein interactions in situ

  • Fluorescence resonance energy transfer (FRET): For monitoring interactions in living cells

  • Bimolecular fluorescence complementation (BiFC): For visualizing interaction locations

Computational approaches:

  • Homology-based prediction of interaction partners

  • Molecular docking simulations

  • Network analysis based on known interactions of homologous proteins

When designing interaction studies, reference approaches used for other chicken proteins. For example, the interaction between chicken MERTK and Newcastle disease virus HN protein was investigated using Co-IP assays with tagged proteins in 293T cells, revealing indirect interactions through ligand proteins (GAS6/ProS1) .

What are common issues encountered when working with recombinant CNPPD1 and how can they be addressed?

Researchers frequently encounter these challenges when working with recombinant CNPPD1:

Solubility problems:

  • Issue: Precipitation after reconstitution

  • Solution: Reconstitute at lower concentration (0.1 mg/mL), adjust buffer pH, add stabilizers like glycerol or BSA

Activity loss:

  • Issue: Decreased or absent functional activity

  • Solution: Avoid freeze-thaw cycles, use freshly reconstituted protein, verify storage conditions, consider native vs. denatured activity requirements

Protein degradation:

  • Issue: Multiple bands on Western blot

  • Solution: Add protease inhibitors, maintain cold chain, reduce handling time

Detection difficulties:

  • Issue: Poor antibody recognition

  • Solution: Try alternative antibodies, verify tag accessibility, consider native vs. denaturing conditions

Experimental variability:

  • Issue: Inconsistent results between experiments

  • Solution: Standardize protein handling protocols, use single batch for complete studies, include internal controls

As with other recombinant proteins, CNPPD1 activity may be affected by experimental conditions. For instance, studies with recombinant chicken adiponectin showed that optimizing induction conditions (1 mM IPTG at 30°C for 3 hours) significantly improved protein quality and yield .

How does the His-tag on recombinant CNPPD1 affect its function and how can this be addressed?

The N-terminal His-tag on recombinant CNPPD1 requires careful consideration:

Potential impacts:

  • Steric hindrance: The tag may block interaction sites, especially if located near functional domains

  • Altered solubility: His-tags can increase protein solubility

  • Non-specific interactions: The tag may introduce artificial binding partners

  • Conformational changes: Tags can affect protein folding and tertiary structure

Addressing tag effects:

  • Tag removal: Consider cleavage with specific proteases if the expression vector contains a cleavage site

  • Control experiments: Compare tagged CNPPD1 with untagged versions when possible

  • Alternative tag positions: C-terminal vs. N-terminal tagging may differently affect function

  • Validation studies: Compare recombinant activity with native protein activity where possible

For critical functional studies, researchers should evaluate whether the tag affects protein activity. If tag removal is necessary, specialized proteases (TEV, thrombin, etc.) can be used depending on the cleavage site engineered into the expression construct.

What are the advantages and limitations of using E. coli-expressed CNPPD1 compared to eukaryotic expression systems?

Each expression system offers distinct advantages and limitations for CNPPD1 production:

E. coli expression advantages:

  • High yield: Typically produces larger quantities of protein

  • Cost-effectiveness: Lower production costs and simpler protocols

  • Rapid production: Shorter time from cloning to purified protein

  • Simplified purification: Well-established methods for His-tagged proteins

E. coli expression limitations:

  • Lack of post-translational modifications: No glycosylation, limited phosphorylation

  • Inclusion body formation: Proteins may require refolding

  • Endotoxin contamination: LPS removal may be necessary for certain applications

  • Incorrect disulfide bond formation: May affect protein structure

Eukaryotic expression systems (insect/mammalian) advantages:

  • Post-translational modifications: More natural glycosylation and phosphorylation

  • Improved folding: Better chaperone systems for complex proteins

  • Secretion capability: Can be engineered for secretion into media

  • Higher likelihood of functional activity: More native-like protein production

Similar considerations have been documented for other chicken recombinant proteins. For instance, when producing chicken recombinant adiponectin, researchers successfully used bacterial expression systems but needed to optimize conditions (30°C induction temperature) to improve solubility and yield .

The choice between expression systems should be guided by the specific experimental requirements and whether post-translational modifications are critical for the intended studies.

How can recombinant CNPPD1 be utilized in studies of avian immune signaling pathways?

Recombinant CNPPD1 offers several applications for investigating avian immune signaling:

While specific CNPPD1 immune functions are not well-established in the literature, research approaches can be modeled after studies with other chicken signaling proteins. For example, chicken MERTK has been shown to regulate the type I interferon signaling pathway and exhibit antiviral activity against Newcastle disease virus .

Potential research applications include:

  • Pathway identification studies:

    • Overexpression of recombinant CNPPD1 in chicken cell lines (like DF-1)

    • Analysis of downstream signaling effects (phosphorylation of potential targets)

    • Transcriptional profiling to identify regulated genes

  • Interaction mapping:

    • Co-immunoprecipitation with known immune signaling components

    • Identification of binding partners in immune cells

    • Characterization of protein complexes during immune challenge

  • Functional immune assays:

    • Effects on cytokine production in immune cells

    • Impact on immune cell activation and proliferation

    • Potential antiviral activity (similar to chMertk's effect against NDV )

  • Knockdown/knockout studies:

    • Compare recombinant protein supplementation effects with gene silencing

The methodological framework established for chicken MERTK, which demonstrated significant effects on STAT1 phosphorylation and downstream expression of IFN-stimulated genes like IFITM3 , provides a valuable template for CNPPD1 studies.

How should researchers analyze and interpret dose-response data with recombinant CNPPD1?

Rigorous analysis of dose-response relationships requires systematic approaches:

  • Experimental design considerations:

    • Use wide concentration range (typically 0.1-1000 ng/mL) with logarithmic spacing

    • Include minimum 5-7 concentration points for robust curve fitting

    • Perform biological replicates (n≥3) with technical duplicates or triplicates

    • Include appropriate controls at each concentration point

  • Data analysis methodology:

    • Plot response vs. log(concentration) rather than linear concentration

    • Apply appropriate curve fitting (four-parameter logistic regression is standard)

    • Calculate key parameters: EC50/IC50, maximum effect, hill slope

    • Use statistical software (GraphPad Prism, R) for consistent analysis

  • Interpretation frameworks:

    • Compare potency (EC50) and efficacy (maximum effect) separately

    • Consider physiological relevance of effective concentrations

    • Assess if dose-response is monotonic or biphasic

    • Evaluate if response saturation was achieved

  • Advanced considerations:

    • Time-dependency of dose-response relationships

    • Cell type-specific variations in response

    • Comparison with endogenous protein activity curves

Following similar approaches used in studies of recombinant chicken MERTK, where dose-dependent effects on STAT1 phosphorylation demonstrated clear response patterns , will strengthen data interpretation and reproducibility.

What statistical approaches are most appropriate for analyzing experimental data involving recombinant CNPPD1?

  • Hypothesis testing frameworks:

    • For comparing two conditions: Student's t-test (parametric) or Mann-Whitney (non-parametric)

    • For multiple conditions: ANOVA with appropriate post-hoc tests (Tukey, Dunnett, etc.)

    • For time-course or repeated measures: Repeated measures ANOVA or mixed models

  • Data presentation standards:

    • Report both effect sizes and p-values

    • Include appropriate error bars (standard deviation for data distribution, standard error for mean precision)

    • Present individual data points alongside means when sample size is small

    • Use consistent significance thresholds (typically p<0.05) as seen in related studies

  • Specialized analytical approaches:

    • For dose-response: Nonlinear regression models

    • For binding studies: Saturation binding analysis

    • For kinetic data: Appropriate enzyme kinetics models

    • For correlation analysis: Pearson or Spearman methods based on data distribution

  • Reproducibility considerations:

    • Perform power analysis to determine appropriate sample sizes

    • Pre-register analysis plans when possible

    • Include both biological and technical replicates

    • Report exact p-values rather than thresholds

Studies on recombinant chicken proteins like MERTK have successfully employed statistical approaches such as comparing treatment groups at multiple timepoints (3, 6, 9, and 12 hours) with appropriate significance testing , providing methodological precedents.

What are promising future research directions for CNPPD1 in avian biology?

Several promising avenues warrant exploration in CNPPD1 research:

  • Functional characterization:

    • Comprehensive identification of signaling pathways influenced by CNPPD1

    • Determination of tissue-specific roles across different avian systems

    • Evaluation of developmental and physiological functions

  • Structural biology approaches:

    • Crystal structure determination of CNPPD1 alone and in complex with interaction partners

    • Structure-function relationship analysis through targeted mutagenesis

    • Molecular dynamics simulations to understand conformational changes

  • Comparative studies:

    • Evolutionary analysis across avian species and comparison with mammalian homologs

    • Functional conservation and divergence assessments

    • Species-specific adaptations in CNPPD1 function

  • Pathological relevance:

    • Potential roles in avian disease processes or stress responses

    • Involvement in immune regulation similar to other chicken proteins like MERTK

    • Application in disease resistance breeding or biotechnology

  • Technological innovations:

    • Development of CNPPD1-specific tools (antibodies, activity assays)

    • CRISPR/Cas9 genome editing to study CNPPD1 function in vivo

    • High-throughput screening systems to identify modulators

These directions would significantly advance understanding of CNPPD1 biology and potentially reveal novel applications in avian research and biotechnology.

How might advances in protein engineering enhance the utility of recombinant CNPPD1 for research?

Protein engineering offers significant opportunities to enhance CNPPD1 research tools:

  • Enhanced expression systems:

    • Development of optimized expression constructs with higher yields

    • Codon optimization for various expression hosts

    • Fusion partners for improved solubility and stability

  • Functional modifications:

    • Creation of constitutively active or dominant negative variants

    • Domain-specific mutations to dissect functional regions

    • Introduction of biorthogonal chemistry handles for specialized labeling

  • Detection improvements:

    • Introduction of split reporter tags for interaction studies

    • Site-specific fluorescent labeling for tracking and imaging

    • Development of conformation-specific sensors

  • Therapeutic potential:

    • Engineering enhanced stability for in vivo applications

    • Development of antagonist or agonist variants

    • Targeted delivery systems for tissue-specific effects

  • High-throughput applications:

    • Arrays of CNPPD1 variants for functional screening

    • Biosensor development for rapid detection of interaction partners

    • Combinatorial approaches to identify optimal functionality

Advances in protein engineering have significantly enhanced research tools for other chicken proteins, such as the successful expression and purification of functional chicken adiponectin as a thioredoxin fusion protein , suggesting similar approaches would benefit CNPPD1 research.

What key considerations should researchers keep in mind when designing experiments with recombinant CNPPD1?

Successful experimentation with recombinant CNPPD1 requires careful attention to several critical factors:

  • Source and quality:

    • Verify protein purity (>90% by SDS-PAGE is standard)

    • Consider expression system limitations (bacterial vs. eukaryotic)

    • Validate batch-to-batch consistency before critical experiments

  • Handling and preparation:

    • Follow precise reconstitution protocols to maintain activity

    • Avoid repeated freeze-thaw cycles

    • Include appropriate glycerol percentage for storage stability

  • Experimental design:

    • Include all necessary controls (positive, negative, vehicle)

    • Design time-course studies to capture optimal response windows

    • Consider concentration-dependent effects with appropriate ranges

  • Functional context:

    • Interpret results within the limited known functional context of CNPPD1

    • Consider potential differences between recombinant and endogenous protein

    • Draw cautious parallels with better-characterized proteins like MERTK

  • Analytical rigor:

    • Apply appropriate statistical methods

    • Report detailed methodological parameters for reproducibility

    • Consider multiple complementary assays to validate observations

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.