Recombinant Chicken Protein cornichon homolog 2 (CNIH2)

Shipped with Ice Packs
In Stock

Description

Definition of Recombinant Chicken Protein Cornichon Homolog 2 (CNIH2)

Recombinant Chicken Protein cornichon homolog 2 (CNIH2) is a protein that, in chickens, is encoded by the Cnih2 gene . CNIH2 regulates the trafficking and gating properties of AMPA-selective glutamate receptors (AMPARs) . It promotes the movement of AMPARs to the cell membrane and synapses .

  • Synonyms CNIH2 is also known as CNIL, protein cornichon homolog 2, CNIH-2, cornichon family AMPA receptor auxiliary protein 2, and cornichon-like protein.

  • Function CNIH2 facilitates the secretion of HB-EGF and plays a crucial role in the proper development of cranial nerves.

  • Location CNIH2 is found in the membrane as a multi-pass membrane protein. In the developing hindbrain, it is expressed in the odd-numbered neuromeres (r3 and r5).

  • Homology CNIH2 belongs to the Cornichon family of proteins.

CNIH2 in Prostate Cancer

CNIH2 has been identified as having prognostic value in prostate cancer .

Prognostic Significance

  • High CNIH2 expression is associated with poorer progression-free survival (PFS) in prostate cancer patients .

  • Patients with low CNIH2 expression exhibited longer PFS than those with high CNIH2 expression .

  • CNIH2 has a robust predictive capability for patient prognosis .

  • CNIH2 is an independent prognostic factor for patients .

Functional Validation

  • Knockdown of the CNIH2 gene significantly inhibited the proliferation of the DU-145, PC-3, and LNCaP cell lines .

  • Downregulation of the CNIH2 gene significantly suppressed the migration and invasion of three cell lines .

  • The growth rate of tumor tissue in the CNIH2 knockdown group was significantly lower .

  • CNIH2 was expressed at higher levels in the prostate tumor tissues of all six patients, while its expression was lower in the adjacent non-cancerous tissues .

The following tables summarize the prognostic significance of CNIH2 in prostate cancer:

Table 1: CNIH2 Expression and Patient Prognosis

Expression LevelPFS Time
CNIH2-lowLonger
CNIH2-highShorter

Table 2: CNIH2 as an Independent Predictor of Prostate Cancer Prognosis

FactorSignificance
CNIH2 gene expressionIndependent
T stageIndependent
Gleason scoreIndependent

CNIH2 in Chicken Breast Meat

A genome-wide association study identified candidate genes regulating nucleotide-related compounds included in chicken breast meat, but it did not specify if CNIH2 was one of those genes .

Table 3: Content of Nucleotide-Related Compounds in Breast Meat of Korean Native Chicken

CompoundMean (mM)
IMP4.97
Inosine1.2
Hypoxanthine0.44

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
CNIH2; CNIL; Protein cornichon homolog 2; CNIH-2; Cornichon family AMPA receptor auxiliary protein 2; Cornichon-like protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-160
Protein Length
full length protein
Species
Gallus gallus (Chicken)
Target Names
CNIH2
Target Protein Sequence
MAFTFAAFCYMLTLVLCASLIFFVIWHIIAFDELRTDFKNPIDQGNPARARERLKNIERI CCLLRKLVVPEYCIHGLFCLMFLCAAEWVTLGLNLPLLLYHLWRYFHRPSDGSEGLFDAV SIMDADILGYCQKEAWCKLAFYLLSFFYYLYSMVYTLVSF
Uniprot No.

Target Background

Function
Cornichon homolog 2 (CNIH2) regulates the trafficking and gating of AMPA-selective glutamate receptors (AMPARs). It plays a crucial role in cranial nerve development by facilitating HB-EGF secretion.
Gene References Into Functions
  1. CNIH2 gene expression in the developing chick brain facilitated HB-EGF secretion. PMID: 17229890
Database Links

KEGG: gga:613230

UniGene: Gga.32579

Protein Families
Cornichon family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in the odd-numbered neuromeres (r3 and r5) of the developing hindbrain.

Q&A

What is the primary function of CNIH2 in neuronal systems?

Unlike other cargo transporters, CNIH2 remains associated with AMPARs during surface transport rather than disengaging after ER export. This represents a novel property in the evolutionary diversification of the mammalian cornichon family, distinguishing CNIH2 from CNIH1, which maintains the ancestral role in cargo export without AMPAR association .

How does CNIH2 interact with AMPA receptors in experimental models?

CNIH2 interacts with AMPAR α-subunits (particularly GluA1-4) early in the secretory pathway and significantly influences receptor properties through:

  • Physical association: CNIH2 directly binds to AMPAR subunits in the ER.

  • Co-trafficking: Unlike typical cargo relationships, CNIH2 remains associated with AMPARs during transport to the cell surface.

  • Subunit specificity: CNIH2 shows preferential effects on different GluA subunits, with particularly strong influence on GluA1 .

  • Functional modulation: When associated with AMPARs at the cell surface, CNIH2 alters channel kinetics, notably slowing desensitization and deactivation .

Experimental evidence demonstrates that CNIH2 deletion causes approximately 54% reduction in AMPAR-evoked excitatory postsynaptic currents (eEPSCs) while having no effect on NMDAR-eEPSCs, confirming its specific role in AMPAR regulation .

What experimental techniques are most effective for studying chicken CNIH2 function?

Based on established methodologies for CNIH2 research, the following approaches are recommended for studying chicken CNIH2:

  • Electrophysiological techniques:

    • Patch-clamp recordings to measure AMPAR currents

    • Ultra-fast glutamate application to assess receptor kinetics

    • Analysis of miniature EPSCs (mEPSCs) for amplitude and decay kinetics

  • Protein expression and trafficking studies:

    • Surface biotinylation assays to quantify membrane expression

    • Glycosylation pattern analysis (Endo H/PNGase F sensitivity) to track protein maturation

    • Extracellular epitope tagging to visualize surface populations

  • Protein-protein interaction analyses:

    • Co-immunoprecipitation studies to identify binding partners

    • FRET/BRET approaches to examine protein interactions in living cells

  • Genetic manipulation:

    • CRE-loxP systems for conditional knockout studies

    • shRNA knockdown in primary neuronal cultures

How evolutionarily conserved is CNIH2 across species, and what are implications for chicken CNIH2 studies?

Cornichon proteins represent an ancient family with homologs found across eukaryotes, from yeast to mammals. Within this family, several important evolutionary considerations apply:

  • The ancestral function of cornichon proteins as cargo exporters in the early secretory pathway is highly conserved across species.

  • Mammalian CNIH2 has gained additional functionality as an AMPAR auxiliary subunit that modifies channel properties at the cell surface.

  • The cornichon family in mammals has diversified, with CNIH1 retaining primarily the ancestral cargo export function, while CNIH2 (and CNIH3) acquired the additional role in AMPAR regulation .

What expression systems are recommended for producing recombinant chicken CNIH2?

Based on established protocols for CNIH2 studies, the following expression systems are recommended:

  • HEK293 cells: Effective for co-expression studies with GluA subunits to examine trafficking and surface expression

  • HeLa cells: Demonstrated utility for studying CNIH2-mediated effects on AMPAR trafficking, as shown in studies where CNIH2 increased GluA1o surface expression by 13.6-fold

  • Primary neuronal cultures: Essential for validating findings in a more physiologically relevant context

  • Insect cell systems: Potentially advantageous for large-scale protein production for structural studies

When expressing recombinant chicken CNIH2, researchers should consider including appropriate epitope tags (e.g., HA, FLAG) for detection while ensuring these modifications don't interfere with protein function. Additionally, codon optimization for the expression system may improve yields .

How does CNIH2 influence AMPAR subunit composition at synapses?

CNIH2 plays a critical role in determining AMPAR subunit composition at synapses, with several key impacts:

  • Subunit-specific effects: Genetic deletion studies reveal that CNIH2 particularly affects GluA1-containing AMPARs. In CNIH2/3 knockout mice, AMPAR-eEPSCs are reduced by approximately 54%, highlighting its importance for functional receptor expression .

  • Kinetic signatures: CNIH2 deletion accelerates AMPAR-EPSC decay in both evoked and miniature recordings. Specifically, both desensitization and deactivation time constants become faster in the absence of CNIH2, indicating its role in modulating channel gating properties .

  • GluA1 dependency: Studies in GluA1 and GluA2 knockout mice demonstrate that CNIH2's effects specifically require GluA1, suggesting a preferential interaction with this subunit .

  • No change in GluA2 content: Despite altering AMPAR properties, CNIH2 deletion does not affect AMPAR-eEPSC rectification, indicating no change in GluA2 content of synaptic receptors .

This evidence suggests CNIH2's critical role in regulating both the abundance and functional properties of specific AMPAR subpopulations at synapses.

What molecular mechanisms underlie CNIH2's dual role in AMPAR trafficking and gating modulation?

CNIH2 possesses a remarkable dual functionality that represents an evolutionary adaptation of an ancient trafficking protein:

  • Trafficking mechanism:

    • CNIH2 cycles between ER and Golgi in a COPII-dependent manner

    • It enhances AMPAR export from the ER by facilitating incorporation into COPII vesicles

    • This function maintains the ancestral role of cornichon proteins as cargo exporters

    • CNIH2 shows isoform-specific effects, with greater enhancement of surface expression for GluA1o (13.6-fold increase) compared to GluA2i (1.4-fold increase)

  • Gating modulation mechanism:

    • Unlike typical cargo-exporter relationships, AMPARs recruit CNIH2 to the cell surface

    • At the membrane, CNIH2 significantly slows AMPAR desensitization (τ⁻ˡᵉⁿˢ = 11.1±1.9 ms with CNIH2 vs. 7.5±3.4 ms without)

    • This provides evidence that CNIH2 has transitioned from solely a trafficking protein to a true auxiliary subunit

  • Integration of functions:

    • CNIH2 appears to influence AMPAR biophysical properties while simultaneously regulating their surface expression

    • This dual role allows for coordinated control of both receptor abundance and kinetic properties

How does CNIH2 influence AMPAR glycosylation and maturation during trafficking?

CNIH2 exerts significant effects on AMPAR glycosylation patterns during trafficking, with important functional consequences:

  • Altered glycosylation profile: Co-expression of CNIH2 with GluA2 results in surface receptors with reduced apparent molecular weight, indicating differences in post-translational modification .

  • Maintained Endo H sensitivity: Surface GluA2 receptors expressed with CNIH2 retain sensitivity to Endoglycosidase H (Endo H), while homomeric GluA2 without CNIH2 is resistant to Endo H but sensitive to PNGase F .

  • Accelerated trafficking of immature receptors: These findings suggest CNIH2 promotes the export of AMPARs with immature glycosylation patterns, potentially accelerating their trafficking through the secretory pathway .

  • Functional implications: This altered glycosylation may contribute to the changes in channel properties observed when AMPARs associate with CNIH2, though the precise relationship between glycosylation state and channel function requires further investigation.

This evidence indicates CNIH2 may serve as a specialized trafficking factor that allows certain AMPAR configurations to bypass complete glycosylation processing while facilitating their surface delivery.

What is the relationship between CNIH2 and TARP auxiliary subunits in AMPAR regulation?

The interplay between CNIH2 and Transmembrane AMPAR Regulatory Proteins (TARPs) represents a complex area of AMPAR biology:

  • Independent modulatory effects: Both CNIH2 and TARPs (such as γ-8) can independently modulate AMPAR properties, though potentially through different mechanisms.

  • No change in TARP stoichiometry: Contrary to some previous hypotheses, deletion of CNIH2 does not alter the kainate/glutamate (IKA/IGlu) ratio, a sensitive assay for γ-8/AMPAR stoichiometry. This finding suggests CNIH2 does not reduce TARP binding to AMPARs as previously proposed .

  • Complementary functions: The distinct effects of CNIH2 and TARPs suggest they may serve complementary rather than redundant roles in AMPAR regulation, potentially targeting different aspects of receptor function or different subpopulations of receptors.

  • Potential for cooperative regulation: The co-existence of both auxiliary protein families in the AMPAR complex suggests possible cooperative regulation, though the precise nature of this interaction remains to be fully elucidated.

These findings indicate that the regulatory landscape for AMPARs involves multiple auxiliary proteins functioning through distinct but potentially coordinated mechanisms .

How can the isoform-specific effects of CNIH2 on different AMPAR subunits be experimentally demonstrated?

CNIH2 exhibits remarkable isoform specificity in its effects on AMPAR trafficking, which can be demonstrated through several experimental approaches:

  • Quantitative surface expression assays:

    • Surface biotinylation combined with western blotting to quantify protein levels

    • Extracellular epitope tagging and immunofluorescence to visualize surface receptors

  • Comparative analysis of flip/flop variants:
    The data reveals pronounced differences in CNIH2's effect on flip versus flop splice variants:

    AMPAR SubunitSurface Expression Increase with CNIH2 (fold)
    GluA1o (flop)13.6 ± 1.0
    GluA1i (flip)3.2 ± 0.2
    GluA2o (flop)2.2 ± 0.1
    GluA2i (flip)1.4 ± 0.1
  • Electrophysiological characterization:

    • Patch-clamp recordings of currents from cells expressing different subunits

    • Analysis of desensitization and deactivation kinetics

    • Measurement of current amplitudes with standardized agonist applications

  • Mutagenesis approaches:

    • Creating chimeric constructs between different GluA subunits to identify domains responsible for differential CNIH2 interaction

    • Point mutations in potential interaction sites to disrupt subunit-specific binding

These experimental approaches can systematically demonstrate and characterize the pronounced subunit-specificity of CNIH2's effects on AMPARs.

What are the critical control experiments when investigating CNIH2 function in heterologous expression systems?

When studying CNIH2 in heterologous systems, several critical controls are essential to ensure valid interpretation of results:

  • Specificity controls:

    • Test non-interacting membrane proteins (e.g., Kir2.1 channels) to confirm CNIH2's effects are specific to AMPARs and not general effects on membrane protein expression

    • Compare effects across multiple AMPAR subunits to establish subunit specificity

  • Trafficking pathway controls:

    • Use dominant-negative Sar1 mutants to block COPII-dependent trafficking and confirm the mechanism of CNIH2's effects

    • Employ brefeldin A to disrupt Golgi function and test dependence on secretory pathway integrity

  • Expression level controls:

    • Titrate CNIH2 expression levels to identify potential concentration-dependent effects

    • Quantify both total and surface expression of target proteins to distinguish effects on production versus trafficking

  • Functional controls:

    • Measure paired-pulse ratios to confirm postsynaptic (vs. presynaptic) effects

    • Compare effects on non-AMPAR ion channels to establish specificity of kinetic modulation

  • Glycosylation analysis controls:

    • Compare Endo H and PNGase F sensitivity to differentiate mature from immature glycosylation patterns

    • Include positive controls for both glycosidase treatments

These controls are essential for distinguishing true CNIH2-mediated effects from artifacts of heterologous expression.

How should researchers reconcile conflicting data about CNIH2 function in different model systems?

Researchers should adopt a systematic approach to address conflicting findings about CNIH2 function:

  • Model system considerations:

    • Different expression systems may yield varying results due to differential expression of endogenous trafficking machinery

    • Primary neurons versus heterologous cells may show different CNIH2 dynamics due to neuron-specific interaction partners

    • Species differences may account for divergent findings, particularly between vertebrate and invertebrate systems

  • Methodological reconciliation:

    • Standardize protein expression levels across systems to control for concentration-dependent effects

    • Apply multiple, complementary techniques to study the same phenomenon

    • Use both acute manipulations (shRNA) and genetic deletions to distinguish between developmental and acute effects

  • Integration of conflicting data:

    • Consider that CNIH2 may have context-dependent functions depending on the presence of other auxiliary proteins

    • The dual role as both trafficking factor and auxiliary subunit may manifest differently depending on experimental conditions

    • Seemingly contradictory data may reveal different aspects of CNIH2's multifunctional nature

  • Experimental design recommendations:

    • Include side-by-side comparisons of different methodologies

    • Test multiple functional readouts (trafficking, surface expression, electrophysiology)

    • Use quantitative approaches to measure CNIH2-AMPAR stoichiometry under different conditions

This integrative approach can help resolve apparent contradictions and develop a more comprehensive understanding of CNIH2 function.

What are the optimal conditions for expressing and purifying recombinant chicken CNIH2?

Based on established protocols for membrane protein expression, the following conditions are recommended:

  • Expression systems:

    • HEK293 or HeLa cells for functional studies

    • Sf9 or High Five insect cells for large-scale protein production

    • Bacterial systems are generally not recommended due to the lack of appropriate post-translational modifications

  • Construct design:

    • Include purification tags (His6, FLAG, or Strep) preferably at the C-terminus to avoid interference with trafficking signals

    • Consider fusion partners (e.g., MBP, SUMO) to improve solubility

    • Include TEV or PreScission protease sites for tag removal

  • Solubilization and purification:

    • Use mild detergents like DDM, LMNG, or GDN for initial solubilization

    • Consider amphipols or nanodiscs for stability during functional studies

    • Apply affinity chromatography followed by size exclusion for highest purity

  • Quality control methods:

    • SDS-PAGE and western blotting to confirm identity and purity

    • Dynamic light scattering to assess homogeneity

    • Circular dichroism to verify proper folding

Each of these parameters may require optimization specifically for chicken CNIH2, as its properties may differ from mammalian homologs.

How can researchers distinguish between CNIH2's trafficking and gating effects in experimental designs?

Distinguishing between CNIH2's dual roles requires careful experimental design:

  • Temporal separation of effects:

    • Use acute surface protein inactivation techniques after trafficking is complete

    • Employ inducible expression systems to control when CNIH2 is present during AMPAR biogenesis

  • Mutational approaches:

    • Develop trafficking-deficient CNIH2 mutants that reach the surface but cannot cycle

    • Create CNIH2 variants that maintain trafficking function but have altered interaction with surface AMPARs

  • Quantitative assays for distinct functions:

    • Measure surface/total protein ratios to quantify trafficking efficiency

    • Use fast glutamate application to measure desensitization kinetics (τdesens) and deactivation kinetics, which directly reflect gating properties

  • Combined approaches:

    MeasurementTrafficking EffectGating Effect
    Surface expressionPrimary indicatorSecondary effect
    Total protein levelsCan be affectedNot directly affected
    EPSC amplitudeCan be affectedCan be affected
    EPSC decay kineticsMinimal impactPrimary indicator
    Desensitization rateNo direct effectPrimary indicator

By systematically applying these approaches, researchers can effectively separate CNIH2's roles in trafficking from its direct effects on channel gating.

What strategies can overcome challenges in detecting native chicken CNIH2-AMPAR complexes?

Detecting native CNIH2-AMPAR complexes presents several challenges that can be addressed through specialized approaches:

  • Antibody-based approaches:

    • Develop chicken-specific CNIH2 antibodies for immunoprecipitation studies

    • Use cross-linking reagents prior to solubilization to preserve transient protein interactions

    • Apply epitope-tagged CNIH2 knock-in strategies in chicken systems for reliable detection

  • Functional detection methods:

    • Compare AMPAR kinetics before and after CNIH2 knockdown/knockout

    • Use electrophysiological fingerprinting to identify CNIH2-containing complexes

    • Apply CNIH2-specific pharmacological tools if available

  • Advanced imaging techniques:

    • Implement single-molecule imaging to detect co-localization and co-trafficking

    • Use FRET/BRET approaches with appropriately tagged proteins

    • Apply super-resolution microscopy to visualize nanoscale distribution patterns

  • Mass spectrometry strategies:

    • Use sophisticated cross-linking mass spectrometry (XL-MS) to capture interaction interfaces

    • Apply native mass spectrometry to determine complex stoichiometry

    • Implement targeted proteomics approaches for detection of low-abundance complexes

These approaches provide complementary information about CNIH2-AMPAR interactions and should be selected based on the specific research question being addressed.

Citations Harmel, N., Cokic, B., Zolles, G., Berkefeld, H., Mauric, V., Fakler, B., Stein, V., & Klöcker, N. (2012). AMPA Receptors Commandeer an Ancient Cargo Exporter for Use as an Auxiliary Subunit for Signaling. Herring, B.E., Shi, Y., Suh, Y.H., Zheng, C.Y., Blankenship, S.M., Roche, K.W., & Nicoll, R.A. (2013). Cornichon proteins determine the subunit composition of synaptic AMPA receptors.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.