Recombinant Chicken Protein odr-4 homolog (ODR4)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Chicken Protein odr-4 homolog (ODR4)

Protein odr-4 homolog (ODR4) is a conserved tail-anchored transmembrane protein initially identified in Caenorhabditis elegans for its role in chemoreceptor localization . The chicken (Gallus gallus) ODR4 homolog is encoded by the ODR4 gene (also known as RCJMB04_10l22) and has been recognized as an important component in cellular pathways related to protein folding, trafficking, and quality control mechanisms . This protein belongs to the broader family of proteins involved in odorant response, with homologs present across multiple species, suggesting evolutionary conservation of function .

The recombinant form of chicken ODR4 protein has been developed to facilitate in-depth research into its structure and functions. This recombinant protein typically includes the full-length sequence (amino acids 1-446) fused to an N-terminal His tag and is expressed in bacterial systems such as Escherichia coli . The availability of this recombinant protein has significantly advanced our understanding of ODR4's biological roles and potential applications.

Physical and Chemical Properties

The recombinant chicken ODR4 protein has several distinct physical and chemical properties that are relevant to its function and handling:

PropertySpecification
Molecular WeightApproximately 50 kDa (including His tag)
FormLyophilized powder
PurityGreater than 90% as determined by SDS-PAGE
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
SolubilityWater-soluble after reconstitution
StabilityStable at -20°C/-80°C; avoid repeated freeze-thaw cycles

The protein contains a transmembrane domain at its C-terminus, making it a tail-anchored protein that can insert into membranes, particularly those of the ER . This structural feature is essential for its localization and function within the cell.

Expression Systems

Recombinant chicken ODR4 protein is typically produced using E. coli expression systems . The gene sequence encoding the full-length protein (amino acids 1-446) is cloned into appropriate expression vectors, incorporating an N-terminal histidine tag to facilitate purification. The expression is optimized to ensure high yield and proper folding of the protein.

Purification Methods

The purification of recombinant chicken ODR4 protein typically follows standard protocols for His-tagged proteins:

  1. Bacterial cell lysis to release expressed proteins

  2. Immobilized metal affinity chromatography (IMAC) using the N-terminal His tag

  3. Additional purification steps as needed (e.g., size exclusion chromatography)

  4. Quality control via SDS-PAGE to confirm purity (>90%)

  5. Lyophilization for stable storage

The purified protein is typically formulated in a Tris/PBS-based buffer containing 6% Trehalose at pH 8.0 to maintain stability . For research applications, the lyophilized protein can be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with the addition of 5-50% glycerol for long-term storage at -20°C/-80°C .

Role in GPCR Biogenesis

One of the most well-characterized functions of ODR4 is its role in G-protein coupled receptor (GPCR) biogenesis. Studies in C. elegans have shown that ODR4, together with ODR-8 (identified as the ortholog of Ufm1-specific protease 2 or UFSP2), is required for the proper localization of a subset of chemoreceptors to sensory cilia .

The ODR-4/ODR-8 complex appears to promote GPCR folding, maturation, or export from the ER . This function is particularly important for olfactory receptors, which form a large and divergent group of GPCRs. The conservation of this protein complex across species suggests that its role in GPCR biogenesis may be evolutionarily conserved from nematodes to vertebrates, including chickens and humans .

Interaction with UFSP2

A critical aspect of ODR4 function is its interaction with UFSP2 (ODR-8 in C. elegans). Both proteins contain MPN domains that enable them to form a dimeric complex . This interaction serves multiple purposes:

  1. It facilitates the proper localization of UFSP2 to the ER membrane

  2. It provides mutual stabilization, as the expression of each protein is significantly lower in cells lacking the other

  3. It creates a functional complex that may be involved in protein quality control mechanisms

The direct association between ODR4 and UFSP2 is essential for the ER localization of UFSP2, which lacks a transmembrane domain of its own . ODR4, being a tail-anchored transmembrane protein, anchors to the ER membrane and serves as a docking site for UFSP2 .

Function in the UFMylation Pathway

Recent research has implicated ODR4 in the UFMylation pathway, a post-translational modification system involving the ubiquitin-like modifier UFM1 . The ODR4-UFSP2 complex appears to play a role in this pathway, although interestingly, the protease activity of UFSP2 may not be essential for all of its functions in GPCR biogenesis .

The UFMylation pathway is involved in various cellular processes, including ER stress response, protein quality control, and cellular homeostasis . By facilitating the proper localization and functioning of UFSP2, ODR4 contributes to these important cellular mechanisms.

In Vitro Studies

Recombinant chicken ODR4 protein serves as a valuable tool for in vitro studies aimed at understanding protein-protein interactions, particularly with UFSP2 and various GPCRs. These studies help elucidate the mechanisms underlying GPCR biogenesis, folding, and trafficking.

The availability of purified recombinant ODR4 also enables structural studies using techniques such as X-ray crystallography or cryo-electron microscopy, which could provide detailed insights into the protein's structure and function. Such structural information would be invaluable for understanding how ODR4 interacts with its binding partners and performs its cellular functions.

Comparative Genomics

The conservation of ODR4 across species makes it an interesting subject for comparative genomics studies. Analysis of ODR4 homologs in different organisms can provide insights into the evolution of GPCR biogenesis pathways and the UFMylation system.

In chickens specifically, research has been conducted as part of broader efforts to understand the regulatory elements and functional annotations of the chicken genome . These studies have implications for both fundamental research and applied fields such as poultry science and veterinary medicine.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference for your use.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ODR4; RCJMB04_10l22; Protein odr-4 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-446
Protein Length
full length protein
Species
Gallus gallus (Chicken)
Target Names
ODR4
Target Protein Sequence
MGRTYFVEEAVGRYLSDLSVKFKPYVTGLLIGQCSPQRDYIIRAARTPPKEEQKEGNTSP SKLDSIDEEWFTAHASQISRMLPGGLLVLSVFIIATPELSKDCQNTLRKLIFSIEKSLTK RRLWKPADEDVSDRAALQICSATKKIVCRTYDVQDPKGSAKPADWKYQSALSASWLSLGC TVNVNIHIPLLATSPNHDLEKNTKNGLNRWSKQIEDSIFLINGQVKDNDIELLEGQKKLR GNTHSGTQIFDVKVLTQLSQGSSHRSTATVQVCSGSINLKGAVKCRAYVHNNKPKVKEAV LALKRDIINTLSDRCEILFEDLILNEGRCKKNFERVYHVLPQRLFVPFAGSNVMLSDYKF GDEAAGEIQERFVEMLDQFVQAEDIHIAEEVNTVGICSLSEKMDDTQLEQLTKATLLLKL QQNMGVVIAVAVAVFASIFSFNYFSD
Uniprot No.

Target Background

Function
May play a role in the trafficking of a subset of G-protein coupled receptors.
Database Links
Protein Families
ODR-4 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the chicken odr-4 homolog and what is its primary function?

The chicken odr-4 homolog is classified as a G-protein coupled receptor (GPCR) localization factor, similar to its counterparts in other species like mice . The protein is believed to play a critical role in the proper trafficking and localization of specific GPCRs to cellular membranes.

In model organisms, ODR4 has been shown to be essential for sensory functions, particularly in chemosensation. While detailed functional characterization in chickens is still developing, comparative genomic analyses suggest conservation of key functional domains that mediate protein-protein interactions with transmembrane receptors.

How is the odr-4 gene structured in the chicken genome?

The chicken odr-4 gene structure follows a conserved pattern observed across vertebrates. Similar to other gene targeting studies in chickens, the odr-4 locus can be precisely mapped and analyzed using modern genomic approaches . The gene contains multiple exons that encode functional domains of the protein, with regulatory elements that control tissue-specific expression patterns.

Researchers should note that when designing experiments targeting this gene, considerations similar to those used for targeting other loci such as DDX4 in chickens may be applicable, including accounting for chromosomal location and regulatory elements .

What expression patterns does odr-4 exhibit in chicken tissues?

The expression of odr-4 in chickens follows a tissue-specific pattern that correlates with its functional requirements. While comprehensive tissue expression data specifically for chicken odr-4 is still being developed, expression analysis methodologies similar to those used for genes like DDX4 in chicken tissues can be applied .

Gene expression database information suggests that in mice, the Odr4 homolog shows specific expression patterns that can be detected through various assay types, and this may provide insights for chicken studies . Researchers should consider employing RNA-Seq analysis to quantify expression levels across different tissues and developmental stages, similar to methods that detected high abundance viral transcripts in chicken models .

What techniques are most effective for producing recombinant chicken ODR4 protein?

For producing recombinant chicken ODR4 protein, bacterial expression systems using E. coli can serve as a starting point, but may result in inclusion bodies due to the protein's transmembrane domains. Alternative expression systems include:

  • Baculovirus-mediated expression in insect cells, which provides more appropriate post-translational modifications

  • Mammalian expression systems (HEK293 or CHO cells) for maintaining protein folding and functionality

  • Cell-free protein synthesis for rapid screening of construct designs

When optimizing expression, researchers should employ a factorial design approach to systematically evaluate parameters affecting protein yield and quality, similar to other biological optimization studies . Critical factors include:

ParameterRange to TestConsiderations
Temperature15-30°CLower temperatures often improve folding
Induction time2-24 hoursProtein-specific optimal window
Inducer concentration0.1-1.0 mM IPTGBalance between expression level and toxicity
Media compositionVarious formulationsEnhanced with specific amino acids if needed

How can TALEN-mediated gene targeting be applied to study ODR4 function in chickens?

TALEN-mediated gene targeting offers a powerful approach for studying ODR4 function in chickens through precise genetic manipulation. Based on successful applications with other chicken genes, this methodology can achieve high efficiency gene targeting .

For ODR4 functional studies, researchers can implement the following TALEN-based approaches:

  • Targeted gene knockout: TALENs can be designed to create specific deletions in the odr-4 locus. Studies have demonstrated that TALENs can generate large deletions (up to 30kb) encompassing entire loci, which would be applicable to odr-4 .

  • Reporter gene integration: Similar to strategies used for the DDX4 locus, homology-directed repair mediated by TALENs can achieve efficient integration (8.1% reported for DDX4) of reporter constructs into the odr-4 locus to track expression .

  • Domain-specific mutations: TALENs can introduce precise modifications to study specific functional domains of the ODR4 protein.

The methodology requires careful design of TALEN pairs targeting the odr-4 locus, followed by transfection into chicken primordial germ cells (PGCs), which can later be used to produce genetically modified chickens for in vivo functional studies .

What experimental controls are essential when analyzing ODR4 protein-protein interactions?

When analyzing ODR4 protein-protein interactions, rigorous controls are essential to ensure data validity:

  • Negative control proteins: Include structurally similar proteins that are not expected to interact with ODR4.

  • Antibody validation: For co-immunoprecipitation studies, validate antibody specificity using knockout or knockdown models.

  • Reciprocal interactions: Confirm interactions by pulling down each putative partner and detecting the other.

  • Subcellular localization confirmation: Verify that the detected interactions occur in relevant cellular compartments using fractionation or imaging techniques.

  • Functional validation: Test whether disrupting the interaction affects known functions through mutagenesis of interaction domains.

Similar to viral protein functional studies, researchers should incorporate appropriate stimulation assays to test the functional consequences of these interactions, such as those used in studying viral IL-4 homologs that demonstrated effects on nitric oxide production in macrophage cell lines .

How should researchers design experiments to study ODR4 trafficking function in avian systems?

Designing experiments to study ODR4 trafficking function requires a multi-faceted approach that addresses both subcellular localization and functional consequences:

  • Live-cell imaging: Utilize fluorescently tagged ODR4 constructs to visualize trafficking in real-time, with considerations for tag position to avoid interfering with function.

  • Pulse-chase experiments: Track newly synthesized ODR4 to determine trafficking kinetics and pathways.

  • Co-localization studies: Examine ODR4 localization relative to known compartment markers and potential cargo proteins.

  • Loss-of-function approaches: Generate conditional knockdowns using RNA interference or TALEN-mediated gene targeting to assess effects on putative cargo proteins .

  • Rescue experiments: Complement knockout models with wild-type or mutant ODR4 to identify critical functional domains.

When implementing these approaches, researchers should consider applying factorial design principles to systematically evaluate multiple variables affecting trafficking, as has been demonstrated effective in other biological systems .

What factors should be considered when designing an ODR4 knockout chicken model?

When designing an ODR4 knockout chicken model, researchers should consider several factors based on successful gene targeting approaches in avian systems:

  • Targeting strategy: Complete gene deletion versus critical exon removal. Similar to strategies used for DDX4, large deletions encompassing the entire odr-4 locus can be created using a single TALEN pair .

  • Developmental effects: Consider potential embryonic lethality if ODR4 is essential for development. Based on studies of other gene knockouts in chickens, staged analysis similar to that performed for DDX4 would be advisable .

  • Sex-specific phenotypes: As seen with DDX4 knockouts, where female chickens showed specific sterility due to germ cell loss during meiosis, researchers should examine both sexes for differential effects .

  • Tissue specificity: Design conditional knockout strategies if global deletion causes early lethality.

  • Phenotypic analysis timeline: Plan for comprehensive phenotypic analysis across different developmental stages, particularly focusing on tissues with high odr-4 expression.

TALEN-mediated gene targeting in avian primordial germ cells (PGCs) has demonstrated high efficiency (8.1% for homology-directed repair), making it a viable approach for generating ODR4 knockout chickens .

How should researchers interpret contradictory data regarding ODR4 function in different avian cell types?

When encountering contradictory data regarding ODR4 function across different avian cell types, researchers should employ a systematic approach to reconciliation:

  • Cell type specificity analysis: Quantify expression levels of ODR4 and its interaction partners across cell types. Similar to RNA-Seq approaches that revealed differential expression of viral transcripts in different contexts, cell-specific differences in expression may explain functional variations .

  • Post-translational modification profiling: Examine whether ODR4 undergoes different modifications in various cell types, potentially explaining functional differences.

  • Interactome comparison: Perform comparative protein-protein interaction studies across cell types to identify cell-specific cofactors.

  • Pathway analysis: Use systems biology approaches to place contradictory findings in the context of cell-type-specific signaling networks.

  • Technical validation: Rule out methodology-based differences by repeating key experiments using standardized protocols across cell types.

When analyzing these complex datasets, researchers should consider that similar contradictions have been observed in viral gene expression studies, where transcript abundance varied significantly between in vitro and in vivo conditions .

What statistical approaches are appropriate for analyzing ODR4 knockout phenotypes?

For analyzing ODR4 knockout phenotypes, researchers should employ robust statistical approaches that account for biological variability and experimental design:

  • Experimental design considerations:

    • Implement factorial design to evaluate multiple factors simultaneously

    • Include appropriate biological and technical replicates

    • Consider sex as a variable, particularly given sex-specific effects observed in other chicken knockout models

  • Statistical methods for phenotypic analysis:

    • ANOVA for comparing multiple experimental groups with post-hoc tests for specific comparisons

    • Mixed models for longitudinal data accounting for repeated measures

    • Non-parametric tests when data doesn't meet normality assumptions

  • Molecular phenotype analysis:

    • Differential expression analysis for transcriptomic data

    • Appropriate normalization methods for protein quantification

    • Enrichment analyses for pathway-level effects

  • Survival analysis:

    • Kaplan-Meier curves for time-to-event data if developmental defects are observed

    • Cox proportional hazards models for multivariate analysis of survival factors

When analyzing complex phenotypic data, the application of response surface equations similar to those used in other experimental designs can help identify optimal conditions and interaction effects between multiple factors .

How can researchers utilize RNA-Seq to characterize ODR4-dependent gene expression networks?

RNA-Seq provides a powerful approach for characterizing ODR4-dependent gene expression networks, particularly when comparing wild-type and knockout models:

  • Experimental design considerations:

    • Include multiple biological replicates (minimum 3-4 per condition)

    • Sample appropriate tissues based on ODR4 expression patterns

    • Consider developmental timepoints if ODR4 function is stage-specific

  • Analytical workflow:

    • Quality control and preprocessing of sequencing data

    • Alignment to reference genome using appropriate tools

    • Quantification of transcript abundance (similar to approaches that quantified viral transcripts per million in chicken samples)

    • Differential expression analysis comparing knockout to wild-type

    • Network inference to identify co-regulated gene modules

  • Validation strategies:

    • qRT-PCR confirmation of key differentially expressed genes

    • Protein-level validation of critical nodes in the network

    • Functional studies of identified network components

  • Interpretation frameworks:

    • Pathway enrichment analysis to identify affected biological processes

    • Transcription factor binding site analysis to identify potential regulators

    • Integration with protein-protein interaction data to build comprehensive networks

This approach has been successfully applied in other contexts, such as viral gene expression studies that identified transcriptional profiles in different chicken tissues and provided insights into functional relevance .

What approaches can be used to determine the crystal structure of chicken ODR4 protein?

Determining the crystal structure of chicken ODR4 presents challenges due to its likely membrane association. Researchers should consider the following approaches:

  • Protein production strategies:

    • Expression of soluble domains separately

    • Use of detergents or amphipols to stabilize full-length protein

    • Lipid cubic phase crystallization for membrane-associated regions

  • Structural determination methods:

    • X-ray crystallography for high-resolution structures of soluble domains

    • Cryo-electron microscopy for full-length protein in near-native state

    • NMR spectroscopy for dynamic regions and smaller domains

  • Computational approaches:

    • Homology modeling based on structures of related proteins

    • Molecular dynamics simulations to predict flexible regions

    • Ab initio modeling for unique domains

  • Strategy for challenging regions:

    • Creation of fusion proteins with crystallization chaperones

    • Surface entropy reduction mutagenesis to promote crystal contacts

    • Nanobody-assisted crystallization to stabilize specific conformations

A systematic experimental design approach, similar to factorial design methods used in other optimization processes, should be employed to screen multiple crystallization conditions efficiently .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.