Recombinant Chicken Protein RER1 (RER1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
RER1; RCJMB04_35f13; Protein RER1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-196
Protein Length
full length protein
Species
Gallus gallus (Chicken)
Target Names
RER1
Target Protein Sequence
MSEGDSIGESVHGKPSVVYRFFTRLGQIYQSWLDKSTPYTAVRWIVTLGLSFIYMIRVYL LQGWYIVTYALGIYHLNLFIAFLSPKVDPSLMEDSDDGPSLPTRQNEEFRPFIRRLPEFK FWHSATKGILVAMACTFFEAFNVPVFWPILVMYFIMLFCITMKRQIKHMIKYRYIPFTHG KRKYKGKEDVGKTFAS
Uniprot No.

Target Background

Function

RER1 is involved in the retrieval of endoplasmic reticulum membrane proteins from the early Golgi compartment.

Database Links
Protein Families
RER1 family
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is Chicken Protein RER1 and what are its primary functions?

    Chicken Protein RER1 (also known as retention in endoplasmic reticulum sorting receptor 1) is a protein that plays a critical role in protein quality control within the endoplasmic reticulum (ER) and Golgi apparatus. It functions primarily as a retention and retrieval receptor that ensures proper assembly of multisubunit protein complexes by retrieving specific proteins from early Golgi compartments back to the ER . This quality control function is essential for maintaining proteostasis (protein homeostasis) within cells. Research using model organisms such as Drosophila has demonstrated that RER1 is indispensable for development, with loss-of-function mutations resulting in larval lethality due to severe proteotoxic stress .

  • What is the subcellular localization of RER1 protein and how does this relate to its function?

    RER1 protein dynamically localizes between the endoplasmic reticulum (ER) and the cis-Golgi compartments . This dual localization is functionally significant as it allows RER1 to monitor protein trafficking between these compartments. Using fluorescent tagging methods such as GFP-RER1 fusion proteins, researchers have confirmed that RER1 colocalizes with both ER markers (like Calnexin) and Golgi markers (such as Golgin-245) in wing epithelial cells of Drosophila . This strategic positioning enables RER1 to function as a quality control checkpoint, recognizing and retrieving incompletely assembled protein complexes or misfolded proteins that have escaped from the ER, thereby preventing their further progression through the secretory pathway.

  • How can researchers detect and quantify RER1 expression in chicken samples?

    Researchers can detect and quantify RER1 expression in chicken samples using several complementary approaches:

    • ELISA: Chicken RER1-specific ELISA kits are available for quantitative detection of RER1 protein in serum, plasma, and other biological fluids. These typically employ a sandwich assay format .

    • Western Blotting: Anti-RER1 antibodies enable detection of RER1 protein in tissue lysates by western blot. Commercially available antibodies may cross-react with chicken RER1 based on sequence homology .

    • Immunohistochemistry (IHC): For localization studies in tissue sections, IHC can be performed using RER1-specific antibodies.

    • qRT-PCR: Quantification of RER1 mRNA expression can be achieved through quantitative real-time PCR using chicken-specific primers.

    When selecting detection methods, researchers should consider that endogenous RER1 expression levels may vary across different tissue types and developmental stages.

Advanced Research Questions

  • What experimental approaches can be used to study the role of RER1 in protein quality control in avian systems?

    To study RER1's role in protein quality control in avian systems, researchers can employ several sophisticated approaches:

    • CRISPR/Cas9-mediated knockout or knockin: Generating RER1 knockout or reporter knockin cell lines (similar to the NANOG-RFP system described for other chicken genes) allows for direct assessment of RER1's function. For RER1 reporter systems, the gene editing should target the endogenous locus to maintain physiological expression patterns.

    • Inducible RNAi systems: Establishing stable chicken cell lines with doxycycline-inducible RER1 shRNA can allow for temporal control over RER1 depletion, facilitating study of acute versus chronic loss.

    • ProteoStat aggresome detection assay: This approach can be used to quantify protein aggregation following RER1 manipulation, as demonstrated in Drosophila studies . The assay uses a molecular rotor dye that becomes fluorescent when bound to aggregated proteins.

    • Immunoprecipitation coupled with mass spectrometry: This approach can identify RER1-interacting proteins in chicken cells, providing insights into substrate specificity and molecular mechanisms.

    • Protein trafficking assays: Using fluorescently-tagged cargo proteins known to require quality control during secretion to monitor their trafficking in the presence or absence of functional RER1.

  • How does loss of RER1 function affect cellular stress responses, and what methodologies can be used to measure these effects?

    Loss of RER1 function triggers multiple cellular stress responses, primarily proteotoxic and oxidative stress. These can be measured through:

    • Unfolded Protein Response (UPR) activation markers: Immunoblotting for phosphorylated eIF2α (p-eIF2α) serves as a primary indicator of PERK-mediated UPR activation. Studies in Drosophila demonstrated significantly elevated p-eIF2α levels in RER1-deficient cells .

    • Oxidative stress assessments: Dihydroethidium (DHE) labeling can detect reactive oxygen species (ROS) production, which increases following RER1 depletion . For chicken cells, CM-H2DCFDA fluorescent probes can also be used to measure general oxidative stress.

    • Cell death assays: Cleaved caspase detection (such as cleaved Death caspase-1 in Drosophila) or Acridine Orange staining can quantify apoptotic cell death resulting from chronic stress responses .

    • Transcriptional profiling: RNA-seq analysis comparing control and RER1-deficient cells can identify activation of stress-responsive gene networks, providing a comprehensive view of the cellular response.

    • Protein aggregation assessment: Techniques such as filter trap assays or fluorescent aggregation reporters can measure the accumulation of misfolded proteins resulting from compromised quality control.

  • What is known about the relationship between RER1 and Myc-induced cellular growth, and how might this apply to avian cell models?

    Research in Drosophila has revealed a significant relationship between RER1 and Myc-driven growth:

    1. Elevated RER1 levels in Myc-overexpressing cells: Studies using GFP-RER1 reporter constructs demonstrated that Myc overexpression increases RER1 protein levels, suggesting a compensatory adaptation to increased proteostasis demands .

    2. Requirement for growth support: Loss of RER1 significantly restricts Myc-induced overgrowth, indicating that RER1 is required to support the high protein synthesis rates driven by Myc activation .

    3. Proteotoxic stress management: Myc-overexpressing cells without adequate RER1 show dramatically increased proteotoxic stress markers (p-eIF2α) and protein aggregation .

    For avian cell models, these findings suggest potential experimental approaches:

    • Generate chicken cell lines with inducible Myc expression and monitor endogenous RER1 levels

    • Assess the impact of RER1 knockdown on Myc-driven phenotypes in chicken cell lines

    • Evaluate whether recombinant chicken RER1 supplementation can rescue growth defects in stressed cells

    This relationship could be particularly relevant for understanding growth regulation in rapidly developing avian embryonic tissues or in pathological contexts like avian tumors.

  • How can researchers generate and validate loss-of-function or gain-of-function models for RER1 in chicken cells?

    For researchers studying RER1 in chicken systems, several approaches can be employed:

    Loss-of-function models:

    • CRISPR/Cas9 knockout: Using the CRISPR/Cas9 system with guide RNAs targeting the chicken RER1 coding sequence. For complete validation, researchers should: (1) perform genomic PCR and sequencing to confirm mutations, (2) conduct qRT-PCR to verify loss of RER1 mRNA, and (3) use western blotting to confirm protein depletion.

    • RNA interference: Designing chicken-specific shRNAs or siRNAs targeting RER1 mRNA. Validation requires demonstrating significant reduction in both RER1 mRNA and protein levels.

    • Dominant negative constructs: Expressing truncated versions of RER1 that interfere with endogenous function.

    Gain-of-function models:

    • Overexpression systems: Using chicken promoters (such as the ovalbumin promoter or its recombinant variants as described in search result ) to drive RER1 expression.

    • Genomic knock-in: Creating GFP-RER1 fusion proteins expressed from the endogenous locus, similar to approaches used in Drosophila studies .

    • Inducible expression systems: Employing tetracycline-inducible promoters to control the timing and level of RER1 expression.

    A key validation approach would include rescue experiments, where phenotypes caused by loss of endogenous RER1 are complemented by expression of exogenous RER1, confirming specificity of the observed effects.

  • What is currently known about the involvement of RER1 in disease models, and how might this inform avian research?

    RER1 has been implicated in several disease contexts that could inform avian research:

    • Neurodegenerative diseases: RER1 interacts with DAP12-TREM2 complexes, which are linked to neurodegenerative conditions. Deletion of RER1 decreases expression of functional TREM2-DAP12 complexes and impairs phagocytic activity in macrophage-like cells .

    • Cancer: RER1 appears in a pyroptosis-related gene signature that predicts prognosis and tumor immune microenvironment in colorectal cancer . This suggests potential roles in regulating inflammatory cell death pathways.

    • Developmental disorders: Studies in Drosophila demonstrate that RER1 is essential for development, with mutants failing to progress beyond larval stages .

    For avian research, these findings suggest several directions:

    1. Investigating RER1's role in avian immune cell function, particularly in macrophage-mediated responses

    2. Exploring RER1 expression in avian tumor models

    3. Examining RER1's function during critical periods of chicken embryonic development

    4. Studying whether RER1 expression levels correlate with stress resistance in commercial poultry breeds

    Research methodologies could include tissue-specific conditional knockouts during development, expression profiling across immune cell populations, and stress challenge experiments in RER1-manipulated systems.

  • How does the structure and function of chicken RER1 compare to its homologs in other species, and what techniques are available to study these evolutionary relationships?

    Chicken RER1 belongs to the evolutionarily conserved RER1 protein family found across eukaryotes from yeast to mammals. To study evolutionary relationships:

    • Sequence comparison analysis: Multiple sequence alignment tools can identify conserved domains and species-specific variations. RER1 homologs have been reported in mouse, rat, bovine, frog, zebrafish, chimpanzee, and chicken species .

    • Phylogenetic analysis: Construction of phylogenetic trees based on RER1 sequences can reveal evolutionary relationships and selection pressures across species.

    • Structural prediction: Homology modeling using known structures of RER1 homologs can predict the tertiary structure of chicken RER1 and identify functional domains.

    • Functional complementation assays: Testing whether chicken RER1 can rescue phenotypes in RER1-deficient cells from other species (like yeast or Drosophila) would provide insights into functional conservation.

    • Domain swapping experiments: Creating chimeric proteins with domains from chicken and other species can identify regions responsible for species-specific functions.

    Current research suggests high functional conservation of RER1's role in protein quality control across species. Studies in Drosophila, yeast, and mammals all demonstrate RER1's critical function in ER-Golgi protein trafficking and ER stress regulation . This conservation suggests that findings from model organisms are likely applicable to chicken RER1 function.

  • What are the implications of RER1's role in cell competition for developmental biology research in avian systems?

    RER1's role in cell competition, as demonstrated in Drosophila studies, has significant implications for avian developmental biology:

    • Tissue quality control: RER1-deficient cells in Drosophila are identified as "loser" cells and eliminated by neighboring wild-type cells through cell competition . This suggests RER1 function contributes to tissue-level quality control mechanisms that could be critical during avian development.

    • Developmental selection: The elimination of cells with compromised proteostasis (due to RER1 deficiency) may represent an evolutionary conserved mechanism to maintain tissue fitness during development.

    • Stress response integration: RER1's involvement in both proteotoxic stress responses and competitive cell survival links these processes, suggesting cellular competition may be partially driven by differences in stress management capabilities.

    For avian research, these findings suggest several experimental approaches:

    1. Mosaic analysis: Generating tissues with mixed populations of wild-type and RER1-deficient cells to observe competitive interactions during chicken embryonic development.

    2. Stress challenge experiments: Testing whether environmental stressors enhance elimination of RER1-compromised cells during development.

    3. Lineage tracing: Following the fate of cells with different RER1 expression levels during critical developmental periods.

    4. Manipulating fitness: Testing whether increasing fitness of neighboring cells (e.g., through Myc overexpression) accelerates elimination of RER1-deficient cells.

    These approaches could reveal how protein quality control mechanisms contribute to cellular selection processes during avian development and tissue maintenance.

Methodological Questions

  • What are the optimal conditions for expressing and purifying recombinant chicken RER1 protein?

    For optimal expression and purification of recombinant chicken RER1 protein:

    Expression systems:

    • Bacterial expression: E. coli can be used for expression of the soluble domains, though membrane-associated regions may present challenges. Addition of an N-terminal fusion tag (His6, GST, or MBP) can improve solubility. Expression at lower temperatures (16-18°C) after IPTG induction may enhance proper folding.

    • Eukaryotic expression: For full-length RER1 with proper post-translational modifications, insect cell (Sf9, Sf21) or mammalian cell (HEK293, CHO) systems are preferable. Baculovirus expression systems are particularly effective for membrane proteins like RER1.

    • Cell-free systems: These can be used for rapid screening of expression conditions prior to scale-up.

    Purification strategy:

    1. Membrane extraction: Use of mild detergents (DDM, LMNG, or Digitonin) to solubilize membrane-associated RER1

    2. Affinity chromatography: Using tagged constructs (His6-tag or GST-tag)

    3. Size exclusion chromatography: To achieve high purity and proper oligomeric state

    4. Ion exchange chromatography: For final polishing and removal of contaminants

    Quality control assessments:

    • SDS-PAGE with Coomassie staining (>90% purity)

    • Western blot verification

    • Mass spectrometry for identity confirmation

    • Circular dichroism to assess secondary structure

    • Size exclusion chromatography with multi-angle light scattering (SEC-MALS) to determine oligomeric state

    The purified protein should be stored in buffer containing stabilizing agents (glycerol, specific lipids) at either -80°C or in liquid nitrogen to maintain functionality.

  • What experimental design considerations are important when studying the effects of RER1 manipulation on the unfolded protein response in avian cells?

    When designing experiments to study RER1's effects on unfolded protein response (UPR) in avian cells, several key considerations should be addressed:

    Manipulation approaches:

    • Temporal control: Use inducible systems (Tet-on/off) rather than constitutive knockdown, as chronic RER1 depletion may trigger compensatory mechanisms that mask acute UPR effects.

    • Dosage effects: Employ partial knockdown (using titratable RNAi) alongside complete knockout to distinguish between hypomorphic and null phenotypes.

    • Rescue controls: Include rescue experiments with RER1 variants (wild-type and mutant versions) to confirm specificity.

    UPR measurement:

    • Diverse UPR branches: Measure markers from all three UPR branches (PERK, IRE1, and ATF6) rather than focusing solely on p-eIF2α .

    • Temporal dynamics: Assess UPR activation at multiple time points post-RER1 manipulation (early, intermediate, and late responses).

    • Pathway-specific reporters: Implement UPR branch-specific fluorescent reporters in chicken cells to monitor activation in real-time.

    Experimental conditions:

    • Basal vs. stressed conditions: Compare RER1 effects under normal conditions and when cells are challenged with UPR inducers (tunicamycin, thapsigargin).

    • Cell type specificity: Test multiple avian cell types (e.g., DF1 fibroblasts, primary hepatocytes, immune cells) as RER1 dependency may vary.

    • Growth conditions: Control for cell density, passage number, and growth phase, which can influence basal UPR status.

    Data analysis approach:

    • Normalization strategy: Use multiple housekeeping genes/proteins that remain stable during UPR activation.

    • Single-cell analysis: Consider flow cytometry or single-cell RNA-seq to detect heterogeneous responses within cell populations.

    • Multivariate analysis: Employ principal component analysis or other multivariate approaches to integrate data from multiple UPR markers.

  • How can researchers establish a reliable quantitative assay to measure RER1-dependent protein quality control in chicken cell systems?

    Establishing a reliable quantitative assay for RER1-dependent protein quality control in chicken cells requires careful selection of readouts and controls:

    Reporter substrate selection:

    1. Known RER1 client proteins: Based on studies in other systems, select proteins known to require RER1 for proper assembly or ER retention, such as components of multisubunit complexes.

    2. Engineered reporters: Design chimeric proteins containing known RER1-dependent retention motifs fused to easily detectable reporters (GFP, luciferase).

    3. Thermosensitive variants: Generate temperature-sensitive mutants of secretory proteins that require enhanced quality control.

    Quantification approaches:

    • Secretion assay: Measure the ratio of intracellular to secreted reporter protein using ELISA or western blotting.

    • Fluorescence localization: Employ fluorescent microscopy to quantify reporter localization across cellular compartments (ER, Golgi, plasma membrane).

    • Flow cytometry: For cell surface expression of membrane proteins that should be retained in absence of proper assembly.

    • Pulse-chase analysis: Track the fate of newly synthesized proteins in presence/absence of functional RER1.

    Controls and validations:

    • Positive controls: Include known substrates of ER quality control that are RER1-independent.

    • Specificity controls: Use chimeric constructs with systematic mutations in retention/retrieval signals.

    • System perturbation: Validate the assay by showing sensitivity to general perturbation of ER-Golgi trafficking (BFA treatment).

    • Rescue experiments: Demonstrate restoration of quality control with reintroduction of RER1.

    Data analysis and normalization:

    • Develop ratiometric measurements (e.g., ER:Golgi or intracellular:secreted) rather than absolute values

    • Include internal standards for normalizing between experiments

    • Establish dose-response relationships with varying levels of RER1 expression/depletion

    Such an assay would enable quantitative assessment of how RER1 contributes to protein quality control in avian cells and could be adapted to high-throughput screening applications.

Looking Forward: Research Frontiers

  • What are the emerging research directions for understanding RER1's role in cellular resilience to stress, particularly in the context of avian development and disease?

    Several cutting-edge research directions are emerging regarding RER1's role in stress resilience:

    Integration with cellular metabolic networks:

    • Investigating how RER1-mediated proteostasis connects with metabolic pathways during development

    • Exploring whether RER1 expression correlates with metabolic shifts during avian embryogenesis

    • Examining if RER1 regulation differs in tissues with varying metabolic demands

    Role in tissue-specific stress adaptation:

    • The Drosophila studies showed RER1 is upregulated in Myc-overexpressing cells to manage proteotoxic stress

    • This suggests investigating tissue-specific regulation of RER1 in rapidly developing avian tissues (limb buds, neural tissues)

    • Examining whether RER1 expression patterns correlate with known developmental stress points

    Environmental stress responses:

    • Exploring RER1's role in adaptation to environmental stressors relevant to poultry (temperature fluctuations, oxidative stress)

    • Investigating whether RER1 polymorphisms correlate with stress resilience in different chicken breeds

    • Assessing RER1 regulation during immune challenges in avian systems

    Therapeutic potential:

    • Evaluating whether increasing RER1 function can protect against proteotoxic stress in disease models

    • Developing small molecules that enhance RER1-dependent quality control

    • Exploring RER1 as a biomarker for cellular stress in diagnostic applications

    Novel methodological approaches:

    • Single-cell transcriptomics to map RER1 expression across developmental trajectories

    • Proximity labeling approaches (BioID, APEX) to identify the dynamic RER1 interactome

    • Optogenetic tools to manipulate RER1 function with spatial and temporal precision

  • How might advances in genome editing technologies be applied to study RER1 function in chicken development and physiology?

    Advanced genome editing technologies offer powerful new approaches to study RER1 function in chickens:

    CRISPR/Cas9-based approaches:

    • Conditional knockout systems: Using floxed alleles and tissue-specific Cre expression to study RER1 function in specific chicken tissues while avoiding developmental lethality.

    • Knock-in reporters: Creating endogenous fluorescent fusion proteins (GFP-RER1) to study dynamic localization without overexpression artifacts.

    • Base editing: Using CRISPR base editors to introduce specific point mutations in RER1 to study structure-function relationships without creating double-strand breaks.

    • Prime editing: Enabling precise insertions or replacements within the RER1 locus to create subtle mutations that alter function rather than completely ablating it.

    Application methods for chicken systems:

    • Embryo injection: Direct injection of CRISPR components into the embryo at early stages (EGK-X) for germline modification .

    • Primordial germ cell modification: Editing RER1 in cultured primordial germ cells followed by transplantation into recipient embryos.

    • Ex ovo electroporation: For somatic cell editing to study RER1 in specific tissues during development.

    • Viral delivery: Using modified avian retroviruses or lentiviruses for targeted delivery of genome editing machinery.

    Advanced functional analyses:

    • Lineage tracing: Combining RER1 modification with genetic lineage tracing to follow cell fate decisions influenced by RER1 function.

    • Transcriptional modulation: Using CRISPRa/CRISPRi systems to modulate RER1 expression levels without altering the gene sequence.

    • Temporal control: Employing photoactivatable or chemically inducible Cas9 systems for precise temporal control over RER1 editing during development.

    • Multiplexed editing: Simultaneous modification of RER1 and interacting partners to study genetic interactions and compensatory mechanisms.

    These approaches could reveal RER1's roles in chicken developmental processes, tissue homeostasis, and stress responses with unprecedented precision and physiological relevance.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.