Recombinant Chicken Protrudin (ZFYVE27)

Shipped with Ice Packs
In Stock

Description

Introduction

Protrudin, also known as ZFYVE27 (zinc finger FYVE-type containing 27), is a protein that, in humans, is encoded by the ZFYVE27 gene . It is implicated in neurite formation by promoting directional membrane trafficking in neurons . Research indicates Protrudin stimulates axon regeneration by shifting endosomes and endoplasmic reticulum into the distal part of cells .

Structure and Function

ZFYVE27 contains a Rab11-binding domain (RBD11) in its N-terminal region and a FYVE domain in its C-terminal end . The protein also possesses a FFAT motif, a coiled-coil domain, and three hydrophobic regions (HR) in its central region . These structural domains are characteristic of a protein involved in membrane-cargo trafficking .

Key structural features of ZFYVE27 :

  • RBD11 Domain: Facilitates interaction with Rab11, a protein regulating membrane traffic at the trans-Golgi network, influencing the recycling of endosomes back to the plasma membrane.

  • FYVE Domain: A lipid-binding domain.

  • FFAT Motif and Coiled-Coil Region: These mediate interaction with VAP-A protein.

  • Hydrophobic Regions (HR): Play a role in protein oligomerization, which is necessary to promote protrusions in non-neuronal cells and neurites in neuronal cells.

Oligomerization of ZFYVE27

ZFYVE27 assembles into a homo-dimer/tetramer, with the core interaction between the monomers primarily mediated through the third hydrophobic region (HR3) motif of the protein . Deletion of HR3 causes re-distribution of wild-type ZFYVE27 into the cytosol and impairs its ability to promote protrusions in non-neuronal cells and neurites in neuronal cells .

Role in Neurite Outgrowth and Axon Regeneration

Overexpression of ZFYVE27 in PC12 cell lines and primary hippocampal neurons leads to extensive neurite outgrowth . Protrudin stimulates axon regeneration by shifting endosomes and endoplasmic reticulum .

Involvement in Angiogenesis

Protrudin regulates angiogenic tube formation in primary endothelial cells, such as Human umbilical vein endothelial cells (HUVECs) . Knockdown of Protrudin inhibits focal adhesion kinase (FAK) activation in HUVECs and human aortic endothelial cells (HAECs), impacting endothelial cell migration and angiogenesis .

Protrudin and Disease

Mutations in the ZFYVE27 gene are associated with hereditary spastic paraplegia (SPG33) . Protrudin may also confer protection to cells that are normally dying, especially in conditions such as glaucoma .

Experimental Evidence

  • Knockdown of Protrudin: Inhibits FAK activation in HUVECs and HAECs, which is associated with a loss of polarized phospho-FAK distribution . Reduction of Protrudin also results in a perinuclear accumulation of mTOR and a decrease in VEGF-mediated S6K activation .

  • Mice with Global Protrudin Deletion: Demonstrate reduced retinal vascular progression .

  • Overexpression of Protrudin: In cultured rat cortical neurons enhances axon regeneration after optic nerve crush with a laser .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
ZFYVE27; RCJMB04_7p9; Protrudin; Zinc finger FYVE domain-containing protein 27
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-406
Protein Length
full length protein
Species
Gallus gallus (Chicken)
Target Names
Target Protein Sequence
MQAAERDGVAGGLEATAAVAATGGGEASSEPPSPPKAASFDLLDLVRSYRRLELYLEPLR DAAEGVRALLRWQRPLCSLLVCLGLNFLLLTLDQAAWYSVLALLVLLPALLGYLQETYRV RPSERELLRRKYHSVRREDLRRVQLSRQEALAQVKCFLIQLEGFLSGLCYNCEAVYRVLY WENPTVSSQFYGALLGSVCILYLLPLCWVMAILNSTLFLGNSQFYQVIKELKASVEQSLG TKPLESAPEPAKPLPTDAPPDRTPTPTSTEDLTPGSVEEAEEAEPDEEFKDAIEEDDEGS QCSADFDLSLPDNGFMSKNDVIRSKVSRLTERLRKRYPSNNFGTCTGCGATFSVLKKRRS CSNCGNSFCSRCCSFKVPKAVMGATAPEAQRETVFVCAQCNQMLIK
Uniprot No.

Target Background

Function
Recombinant Chicken Protrudin (ZFYVE27) is a key regulator of RAB11-dependent vesicular trafficking during neurite extension via polarized membrane transport. It promotes axonal elongation and contributes to establishing neuronal cell polarity. It is involved in nerve growth factor-induced neurite formation in a VAPA-dependent manner and contributes to both the formation and stabilization of the tubular endoplasmic reticulum (ER) network. Its role in ER morphogenesis involves regulating the sheet-to-tubule balance and potentially the density of tubule interconnections.
Database Links
Subcellular Location
Recycling endosome membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein. Cell projection, growth cone membrane; Multi-pass membrane protein.

Q&A

What is Protrudin (ZFYVE27) and what is its primary function?

Protrudin, also known as ZFYVE27, is a novel member of the FYVE protein family that plays a crucial role in the formation of neurite extensions by promoting directional membrane trafficking in neurons. It was originally identified as an interacting partner of spastin, a protein frequently mutated in hereditary spastic paraplegia . ZFYVE27 functions at the interface of membrane dynamics and cytoskeletal organization, facilitating the extension of cellular protrusions through its interactions with various proteins and membrane components. When overexpressed in both neuronal and non-neuronal cells, ZFYVE27 induces the formation of neurites and protrusions, respectively, from the cell soma . This activity appears to be dependent on ZFYVE27's ability to correctly localize and oligomerize, establishing it as an important determinant in directional membrane transport during neurite formation.

What structural domains characterize ZFYVE27 protein?

ZFYVE27 contains multiple structural domains that contribute to its function and interactions. Key structural features include:

  • Hydrophobic regions: ZFYVE27 contains at least three hydrophobic regions (HR), with the third hydrophobic region (HR3, amino acids 185-207) being particularly crucial for oligomerization .

  • FYVE domain: Located at the C-terminus (amino acids 300-404), this domain is responsible for binding to phosphatidylinositol 3-phosphate (PtdIns3P). Interestingly, the FYVE domain of ZFYVE27 lacks the conserved FYVE signature motifs (WXXD, RVC, and R(R/K)HHCR) typically found in other FYVE family proteins, yet it still binds specifically to PtdIns3P .

  • Coiled-coil region: Present in the C-terminal portion, this region may contribute to protein-protein interactions and stabilization of oligomeric structures .

  • N-terminal region: The region containing HR1 and HR2 motifs appears to contribute to stabilizing the oligomeric structure of ZFYVE27 .

These structural elements work in concert to enable ZFYVE27's functions in membrane trafficking and neurite extension, with the HR3 region being particularly critical for the formation of functional oligomers.

How does ZFYVE27 oligomerization contribute to its biological function?

Oligomerization of ZFYVE27 is essential for its ability to promote neurite extensions. Research has demonstrated that ZFYVE27 forms dimers and tetramers, as revealed by sucrose gradient centrifugation experiments . This oligomerization primarily occurs through interactions at the HR3 region (amino acids 185-207), although other regions of the protein also contribute to stabilizing the oligomeric structure .

The functional significance of this oligomerization becomes evident when examining the effects of HR3 deletion. Cells expressing ZFYVE27(ΔHR3) fail to produce protrusions and instead exhibit swelling of the cell soma . Moreover, when ZFYVE27(ΔHR3) is co-expressed with wild-type ZFYVE27, it exerts a dominant negative effect, preventing the formation of protrusions and causing cytoplasmic swelling . This indicates that proper oligomerization is crucial for ZFYVE27's ability to promote directional membrane trafficking and the subsequent formation of neurite extensions.

Similar to other FYVE domain-containing proteins like EEA1 and Hrs that form functional oligomers, ZFYVE27 dimers might constitute a tetrameric quaternary structure that is necessary for proper spatial organization of its interactions with membranes and binding partners .

What techniques are used to study ZFYVE27 interactions?

Several complementary techniques have been employed to study ZFYVE27 interactions:

  • Yeast Two-Hybrid (Y2H) Screen: This method was used to identify ZFYVE27's self-interaction and map the core interaction region to the HR3 motif. The technique involves creating bait constructs with full-length ZFYVE27 and various deletion constructs to assess protein-protein interactions .

  • Co-immunoprecipitation: This technique confirmed ZFYVE27's self-interaction in mammalian cells. Researchers co-expressed differently tagged versions of ZFYVE27 (e.g., c-Myc-ZFYVE27 and E2-ZFYVE27) and used antibodies against one tag to precipitate the protein complex, then detected the presence of the other tagged protein by Western blot .

  • Co-localization Studies: Fluorescently tagged ZFYVE27 constructs were used to visualize the cellular distribution of wild-type and mutant proteins, confirming their interactions and functional consequences .

  • Sucrose Gradient Centrifugation: This method was used to determine the oligomeric state of ZFYVE27, revealing that it forms dimers and tetramers .

  • Liposomal Assays: PolyPIPosomes containing PtdIns3P were used to demonstrate ZFYVE27's ability to bind phosphatidylinositol 3-phosphate, using both full-length protein from cell lysates and recombinant GST-ZFYVE27 fragments .

These diverse approaches provided complementary evidence for ZFYVE27's self-interaction, oligomerization, and lipid-binding properties, establishing a comprehensive understanding of its molecular behavior.

What experimental approaches can be used to study oligomerization of recombinant chicken ZFYVE27?

To study the oligomerization of recombinant chicken ZFYVE27, researchers can employ several sophisticated experimental approaches:

  • Sucrose Gradient Centrifugation: This technique separates proteins based on their molecular weight and shape. For ZFYVE27, this method has successfully demonstrated its oligomerization into dimer/tetramer forms . The protocol involves loading protein samples onto a sucrose gradient (typically 5-20%), centrifuging at high speed (≥100,000×g), collecting fractions, and analyzing them by Western blotting to determine the oligomeric state.

  • Analytical Ultracentrifugation: This provides precise measurements of sedimentation coefficients and molecular weights, offering more detailed information about the hydrodynamic properties and stoichiometry of ZFYVE27 oligomers.

  • Size Exclusion Chromatography with Multi-Angle Light Scattering (SEC-MALS): This combination allows determination of absolute molecular weight and oligomeric state independent of shape considerations.

  • Cross-linking Studies: Chemical cross-linkers of varying lengths can be used to stabilize transient protein-protein interactions in vitro or in vivo, followed by SDS-PAGE and Western blotting to visualize oligomeric species.

  • Fluorescence Resonance Energy Transfer (FRET): By tagging ZFYVE27 with appropriate fluorophore pairs, researchers can monitor protein-protein interactions in living cells and obtain spatial information about oligomerization.

For recombinant expression of chicken ZFYVE27 specifically, researchers should consider codon optimization for the expression system of choice and include appropriate purification tags that can be removed without disrupting oligomerization .

How can researchers investigate the functional consequences of mutations in the HR3 region?

Investigating the functional consequences of HR3 region mutations requires a multi-faceted approach:

  • Site-Directed Mutagenesis: Generate point mutations or small deletions within the HR3 region (amino acids 185-207) of chicken ZFYVE27. Based on studies with human ZFYVE27, complete deletion of HR3 (ZFYVE27(ΔHR3)) prevents oligomerization and neurite/protrusion formation .

  • Oligomerization Assessment: Compare the oligomerization capacity of wild-type and mutant proteins using techniques like sucrose gradient centrifugation, co-immunoprecipitation, and FRET to determine how specific mutations affect self-interaction.

  • Cellular Morphology Analysis: Express wild-type or mutant ZFYVE27 in neuronal and non-neuronal cells and quantify:

    • Number and length of neurites/protrusions

    • Incidence of cell soma swelling

    • Membrane trafficking dynamics

  • Dominant-Negative Effects: Co-express wild-type and mutant ZFYVE27 at different ratios to assess potential dominant-negative effects, as observed with ZFYVE27(ΔHR3) .

  • Live Cell Imaging: Use fluorescently tagged constructs to monitor the dynamics of membrane trafficking and neurite extension in real-time, comparing wild-type and mutant proteins.

  • Protein-Protein Interaction Analysis: Assess how HR3 mutations affect ZFYVE27's interactions with known binding partners such as spastin, as these interactions may be independent of HR3-mediated oligomerization .

This comprehensive approach will provide insights into both the structural requirements for ZFYVE27 oligomerization and the functional significance of specific residues within the HR3 region.

What methods can be used to study ZFYVE27's membrane association and lipid binding properties?

ZFYVE27's interaction with membranes and lipids can be investigated using the following methodologies:

  • Subcellular Fractionation: This technique separates cellular components based on their density and size. For ZFYVE27, it has been used to demonstrate its nature as a peripheral membrane protein rather than an integral membrane protein .

  • Triton X-114 Membrane Phase Separation: This method distinguishes between peripheral and integral membrane proteins based on their hydrophobicity. ZFYVE27 was shown to be a peripheral membrane protein using this approach .

  • Liposomal Binding Assays: PolyPIPosomes containing specific phosphoinositides (e.g., PtdIns3P) can be used to assess lipid binding specificity. This technique demonstrated that ZFYVE27 binds specifically to PtdIns3P despite lacking the canonical FYVE domain signature motifs .

  • Protein-Lipid Overlay Assays (PIP Strips): Commercial strips containing various immobilized phospholipids can be incubated with recombinant ZFYVE27 to determine its lipid binding profile.

  • Surface Plasmon Resonance (SPR): This technique provides quantitative measurements of binding affinities between ZFYVE27 and lipid vesicles of defined composition.

  • Fluorescence Microscopy with Lipid Sensors: Co-localization of ZFYVE27 with specific phosphoinositide sensors in cells can reveal the lipid microenvironment in which ZFYVE27 operates.

  • Recombinant Protein Expression: For chicken ZFYVE27 specifically, expressing the FYVE domain (amino acids 300-404) as a GST fusion protein provides a useful tool for in vitro lipid binding studies, as demonstrated with human ZFYVE27 .

How can researchers study the interplay between ZFYVE27 and spastin in neuronal models?

The interaction between ZFYVE27 and spastin, which is frequently mutated in hereditary spastic paraplegia, can be studied through various experimental approaches:

  • Co-immunoprecipitation: This technique can verify the interaction between chicken ZFYVE27 and spastin in cellular models. Previous studies have shown that spastin interacts with both wild-type ZFYVE27 and ZFYVE27(ΔHR3), suggesting this interaction is independent of HR3-mediated oligomerization .

  • Proximity Ligation Assay (PLA): This method detects protein-protein interactions in situ with high sensitivity and specificity, providing spatial information about where ZFYVE27 and spastin interact within neurons.

  • FRET or Bimolecular Fluorescence Complementation (BiFC): These techniques allow visualization of protein-protein interactions in living cells and can reveal the dynamics of ZFYVE27-spastin interactions.

  • Domain Mapping: Generate truncated versions of both proteins to identify the specific domains mediating their interaction, similar to the approach used for mapping ZFYVE27's self-interaction regions .

  • Neuronal Cultures from Transgenic Models: Primary neuronal cultures from spastin-deficient or ZFYVE27-deficient models can reveal the functional interdependence of these proteins in neurite formation.

  • Microtubule Dynamics Assays: Since spastin is a microtubule-severing enzyme, researchers can assess how ZFYVE27-spastin interactions affect microtubule dynamics, using live-cell imaging of fluorescently labeled tubulin.

  • Rescue Experiments: In neurons with spastin mutations, test whether overexpression of wild-type or mutant ZFYVE27 can rescue defects in neurite formation or membrane trafficking.

This multi-faceted approach can provide insights into how ZFYVE27-spastin interactions contribute to neuronal development and the pathogenesis of hereditary spastic paraplegia.

What expression systems are optimal for producing recombinant chicken ZFYVE27?

Selecting the appropriate expression system for recombinant chicken ZFYVE27 requires careful consideration of protein characteristics and experimental goals:

  • Bacterial Expression Systems (E. coli):

    • Advantages: High yield, cost-effective, rapid expression

    • Considerations: May lack proper post-translational modifications; membrane-associated proteins like ZFYVE27 may form inclusion bodies

    • Recommendation: Express specific domains (e.g., FYVE domain) rather than full-length protein, as was done with GST-ZFYVE27 300-404 for lipid binding studies

    • Use specialized strains designed for eukaryotic protein expression (Rosetta, Arctic Express)

  • Insect Cell Systems (Baculovirus):

    • Advantages: Better post-translational modifications, suitable for membrane-associated proteins

    • Considerations: Higher cost, more complex methodology

    • Recommendation: Consider for full-length chicken ZFYVE27 expression, especially when studying oligomerization

  • Mammalian Cell Expression:

    • Advantages: Most physiologically relevant modifications and folding

    • Considerations: Lower yield, highest cost

    • Recommendation: Ideal for functional studies examining protein localization and interactions in cellular context

  • Cell-Free Expression Systems:

    • Advantages: Rapid, allows expression of toxic proteins

    • Considerations: Limited post-translational modifications

    • Recommendation: Useful for preliminary structure-function analyses

For chicken ZFYVE27 specifically, consider:

  • Codon optimization for the chosen expression system

  • Inclusion of appropriate purification tags (His, GST, etc.) that can be removed without disrupting function

  • Expression of truncated versions to overcome solubility issues with full-length protein

  • Adding stabilizing partners or ligands during expression to improve folding and solubility

What controls should be included in ZFYVE27 oligomerization studies?

Rigorous experimental design for ZFYVE27 oligomerization studies requires the following controls:

  • Positive Controls:

    • Known oligomeric FYVE domain-containing proteins (e.g., EEA1) processed in parallel

    • Previously characterized constructs of human ZFYVE27 for comparison with chicken ZFYVE27

    • Artificial dimers/tetramers of known molecular weight as size standards

  • Negative Controls:

    • ZFYVE27(ΔHR3) construct, which has been shown to disrupt oligomerization

    • Monomeric mutants of related FYVE proteins

    • Heat-denatured samples to confirm oligomer disruption

  • Specificity Controls:

    • Non-specific protein of similar size and charge properties

    • Scrambled peptide corresponding to the HR3 region

    • Competition assays with HR3 peptides to disrupt oligomerization

  • Technical Controls:

    • Concentration dependence analysis to distinguish between specific oligomerization and non-specific aggregation

    • Multiple detection methods (e.g., Western blot with different antibodies, silver staining)

    • Cross-validation with different experimental approaches (e.g., sucrose gradient centrifugation, analytical ultracentrifugation, cross-linking)

  • Biological Validation:

    • Correlate oligomerization state with functional readouts (neurite extension, protrusion formation)

    • Structure-function analyses with point mutations rather than complete domain deletions

    • In vivo confirmation of oligomeric states in cellular contexts

How should researchers optimize conditions for studying ZFYVE27's membrane trafficking role?

Optimizing experimental conditions for studying ZFYVE27's membrane trafficking function requires attention to several critical factors:

  • Cell Type Selection:

    • Neuronal cell lines (e.g., PC12, SH-SY5Y) for studying neurite extension

    • Primary neurons for physiologically relevant contexts

    • Non-neuronal cells (e.g., NIH-3T3) for basic protrusion formation studies, as used in previous research

    • Consider species-matching (chicken neurons for chicken ZFYVE27) to maintain relevant interaction partners

  • Expression Level Considerations:

    • Establish dose-response relationships between ZFYVE27 expression and phenotypic outcomes

    • Use inducible expression systems to control timing and level of expression

    • Compare endogenous vs. overexpression phenotypes to avoid artifacts

  • Visualization Strategies:

    • Fluorescent protein tags (ensure tags don't interfere with oligomerization)

    • Live-cell imaging with spinning disk or TIRF microscopy for dynamic processes

    • Super-resolution techniques (STED, PALM/STORM) for detailed subcellular localization

    • Fluorescent cargo tracking to measure directional transport efficiency

  • Temporal Considerations:

    • Establish appropriate time points for observation (short-term vs. long-term effects)

    • Use photoactivatable or photoswitchable fluorescent proteins for pulse-chase experiments

    • Implement fast image acquisition for capturing rapid membrane trafficking events

  • Pharmacological Tools:

    • Microtubule-disrupting agents to assess cytoskeletal requirements

    • PI3K inhibitors to manipulate PtdIns3P levels and test lipid binding dependency

    • Rab11 modulators to investigate the ZFYVE27-Rab11 axis in directional transport

  • Quantification Methods:

    • Automated image analysis for unbiased quantification of neurite/protrusion number, length, and branching

    • Fluorescence recovery after photobleaching (FRAP) to measure membrane protein dynamics

    • Ratiometric measurements comparing membrane vs. cytosolic localization

These optimized conditions will enable researchers to rigorously investigate ZFYVE27's role in directional membrane trafficking and neurite extension.

How can researchers accurately quantify ZFYVE27-induced morphological changes?

Accurate quantification of morphological changes induced by ZFYVE27 expression requires robust image analysis approaches:

  • Standardized Image Acquisition:

    • Consistent microscopy settings (exposure, gain, resolution)

    • Random field selection to avoid observer bias

    • Sufficient sample size (typically >100 cells per condition across 3+ independent experiments)

    • Z-stack acquisition to capture the full three-dimensional cellular morphology

  • Quantitative Parameters to Measure:

    • Number of protrusions/neurites per cell

    • Length of protrusions/neurites (maximum and average)

    • Branching complexity (primary, secondary, tertiary branches)

    • Cell soma size (to detect swelling as reported with ZFYVE27(ΔHR3) )

    • Distribution of ZFYVE27 along protrusions (intensity profile analysis)

  • Automated Analysis Tools:

    • ImageJ/Fiji with NeuronJ or Simple Neurite Tracer plugins

    • CellProfiler for high-throughput morphological analysis

    • Machine learning approaches for unbiased classification of morphological phenotypes

  • Comparative Analysis:

    • Wild-type vs. mutant ZFYVE27 (especially HR3 region mutations)

    • Dose-dependent effects (correlation between expression level and phenotype)

    • Temporal analysis to distinguish primary from secondary effects

    • Co-expression experiments (e.g., ZFYVE27(WT) with ZFYVE27(ΔHR3)) to assess dominant-negative effects

  • Statistical Approaches:

    • Non-parametric tests when data doesn't follow normal distribution

    • Mixed-effects models to account for experimental variability

    • Multiple comparison corrections for analyzing various parameters simultaneously

    • Power analysis to ensure sufficient sample size

Following these guidelines will enable researchers to obtain reliable quantitative data on ZFYVE27-induced morphological changes and make valid comparisons between experimental conditions.

What are the common pitfalls in interpreting ZFYVE27 oligomerization data?

Interpreting oligomerization data for ZFYVE27 presents several challenges that researchers should be aware of:

  • Concentration-Dependent Effects:

    • At high concentrations, non-specific aggregation may be mistaken for specific oligomerization

    • Solution: Perform analyses across a range of protein concentrations and extrapolate to physiological levels

  • Detergent Sensitivity:

    • Choice of detergent can affect membrane protein oligomerization states

    • Solution: Compare multiple detergents and use complementary methods like cross-linking prior to solubilization

  • Tag Interference:

    • Purification or fluorescent tags may alter oligomerization properties

    • Solution: Use small tags, verify results with differently tagged constructs, and include tag-only controls

  • Equilibrium Considerations:

    • Oligomerization may be dynamic with multiple states in equilibrium

    • Solution: Use techniques that capture the native distribution (e.g., native PAGE, in-cell cross-linking)

  • Heterogeneity in Expression Systems:

    • Different expression systems may yield proteins with varying post-translational modifications

    • Solution: Characterize and compare ZFYVE27 from different expression systems

  • Method-Specific Artifacts:

    • Different techniques can yield apparently contradictory results

    • For example, Y2H assays with ZFYVE27(ΔHR3) showed no interaction with ZFYVE27(WT), while co-immunoprecipitation detected interaction

    • Solution: Use multiple complementary methods and understand the limitations of each

  • Extrapolating from In Vitro to In Vivo:

    • Purified protein behavior may differ from behavior in cellular environments

    • Solution: Validate in vitro findings with cellular experiments

  • Chicken vs. Human ZFYVE27 Differences:

    • Sequence variations between species may affect oligomerization properties

    • Solution: Perform comparative studies and identify conserved vs. divergent features

How can researchers differentiate between direct and indirect effects in ZFYVE27 functional studies?

Distinguishing direct from indirect effects in ZFYVE27 functional studies requires careful experimental design:

  • Temporal Analysis:

    • Implement time-course experiments to identify primary (rapid) versus secondary (delayed) effects

    • Use inducible expression systems to control the onset of ZFYVE27 expression with high temporal precision

    • Employ fast-acting inhibitors or optogenetic tools to acutely manipulate ZFYVE27 function

  • Structure-Function Approaches:

    • Generate targeted mutations that affect specific functions while preserving others

    • For example, mutations in the FYVE domain might affect lipid binding without disrupting oligomerization

    • Compare these selective mutations with broader disruptions like HR3 deletion

  • In Vitro Reconstitution:

    • Reconstitute minimal systems with purified components to test direct effects

    • For example, test whether purified ZFYVE27 directly affects membrane deformation using synthetic liposomes

    • Add components systematically to identify which interactions are sufficient for specific functions

  • Acute Protein Manipulation:

    • Use proteolytic degradation systems (e.g., Auxin-inducible degron) for rapid protein depletion

    • Apply protein-protein interaction inhibitors to specifically disrupt certain ZFYVE27 interactions

    • Utilize knockout/knockin approaches rather than overexpression when possible

  • Pathway Analysis:

    • Systematically inhibit potential intermediary pathways

    • Use phosphoproteomics or other -omics approaches to identify signaling cascades activated by ZFYVE27

    • Perform epistasis experiments with known interactors like Rab11

  • Proximity-Based Approaches:

    • Use BioID, APEX, or similar proximity labeling techniques to identify proteins in the immediate vicinity of ZFYVE27

    • Compare proximity profiles of wild-type and functional mutants

    • Correlate direct interaction partners with functional phenotypes

  • Mathematical Modeling:

    • Develop predictive models incorporating known ZFYVE27 interactions and functions

    • Test model predictions experimentally to validate direct causal relationships

    • Use parameter fitting to distinguish between alternative mechanistic hypotheses

These approaches will help researchers build a more accurate mechanistic understanding of ZFYVE27's direct functional roles versus downstream consequences of its activity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.