Recombinant Chicken Smoothened homolog (SMO)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
SMO; SMOH; Smoothened homolog; SMO; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
16-794
Protein Length
Full Length of Mature Protein
Species
Gallus gallus (Chicken)
Target Names
SMO
Target Protein Sequence
PRRCPAAPLNASAAPPERCRRPAACERLRFGSCLGSALPYAHTSTLLAADSGSQEEAHGK LLLWSGLRNAPRCWDVIQPLLCAVYMPKCEDGQVELPSQTLCQATRAPCTIVERERGWPD FLKCTPDRFPEGCPNEVQNIKFNSSGQCEAPLVRTYNPKSWYEDVEGCGIQCQNPLFTET EHREMHVYIAFSSVTISCTFFTLATFVADWRNSNRYPAVILFYVNACFFVGSIGCVAQFM DGARDEIVCRADGTMRLGEPTSNETLSCVIIFVIVYYSLMSGVIWFVMLTYAWHTSFKAL GTTYQPLLGKTSYFHLITWSIPFVLTVAILAVAQVDGDSVSGICFVGYKNYRYRAGFVLA PIGLVLIVGGYFLIRGVMTLFSIKSNHPGLLSEKAASKINETMLRLGIFGFLAFGFVFIT FGCHFYDFFNQAEWERSFREYVLCEANVTIATQTNKPIPECEIKNRPSLLVEKINLFAMF GTGISMSTWVWTKATLLIWKRTWCRLTGQSDDQPKRIKKSKMIAKAFSKRKELLRDPGRE LSFSMHTVSHDGPVAGLAFDINEPSADVSSAWAQHVTKMVARRGAILPQDVSVTPVATPV PPEERSNLWVVEADVSPELQKRSRKKKRRKKKKEEVCPERRAGLSVAPLTPSSVPRLPRL PQQPCLVAIPRHRGDTFIPTVLPGLSNGAGGLWDGRRRAHVPHFITNPFCPESGSPEDEE NPGPSVGHRQHNGGRRWPPEPLPGGSGVTRTRGRRAGLAPIHSRTNLVNAELLDADLDF
Uniprot No.

Target Background

Function

Smoothened (SMO) is a G protein-coupled receptor that likely interacts with the patched protein (PTCH) to mediate hedgehog signaling. Sonic hedgehog (SHH) binding to PTCH is believed to inhibit PTCH's usual suppression of SMO activity.

Database Links

UniGene: Gga.4082

Protein Families
G-protein coupled receptor Fz/Smo family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Smoothened homolog (SMO) and what is its function in chickens?

Smoothened homolog (SMO) is a G protein-coupled receptor (GPCR) that functions as a key transducer in the Hedgehog (Hh) signaling pathway. In chickens, as in other vertebrates, SMO plays an essential role in embryonic development, controlling cell maturation, differentiation, and proliferation . The protein contains an extracellular cysteine-rich domain (CRD) that is indispensable for its function and downstream Hh signaling . When the Hedgehog ligand binds to its receptor Patched (Ptc), it prevents normal inhibition of SMO, allowing SMO to transduce the Hedgehog signal and ultimately influence gene expression through the Gli transcription factor family .

What methods are available for detecting recombinant chicken SMO in experimental systems?

Several methods can be employed to detect recombinant chicken SMO:

  • Western Blotting: Using specific antibodies against SMO or epitope tags (such as myc or HA) if the recombinant protein is tagged. Polyclonal antibodies with predicted reactivity to chicken SMO are commercially available .

  • Immunofluorescence: For cellular localization studies, as demonstrated in primary cell cultures from chick limbs at HH20-24 stages. Cells can be transfected with tagged SMO constructs and visualized using fluorescence microscopy .

  • Nuclear and Cytosol Fractionation: To determine the subcellular localization of SMO, tissues can be homogenized and fractionated to separate nuclear and cytoplasmic components using specialized extraction kits .

  • Flow Cytometry: For quantitative analysis of SMO expression in cell populations, particularly useful when studying the effects of mutations or treatments on SMO trafficking.

What are the optimal expression systems for producing recombinant chicken SMO?

Based on successful approaches with similar proteins:

Expression SystemAdvantagesLimitationsOptimal For
E. coliHigh yield, cost-effective, rapid expressionLimited post-translational modifications, challenging for full-length membrane proteinsIsolated domains (e.g., C-terminal tail or CRD)
Insect cells (Sf9, Sf21)Better for membrane proteins, more mammalian-like post-translational modificationsModerate yield, more expensive than bacterial systemsFull-length SMO or large functional domains
Mammalian cells (HEK293, CHO)Native-like folding and post-translational modificationsLower yield, expensive, time-consumingFull-length SMO with proper glycosylation and folding

For specific domains like the cytoplasmic tail of SMO (SMOct), E. coli expression systems have been successfully used with isotopic labeling for NMR studies . For full-length SMO, which is a multi-pass transmembrane protein, insect or mammalian expression systems are preferable to maintain proper folding and functionality.

What purification strategies are most effective for recombinant chicken SMO?

Purification of recombinant chicken SMO typically involves:

  • Affinity Chromatography: Using fusion tags such as His-tag, FLAG, or GST for initial capture. Protein A purification has been successfully used for antibodies targeting SMO .

  • Size Exclusion Chromatography: To separate properly folded protein from aggregates and other impurities based on molecular size.

  • Ion Exchange Chromatography: For further purification based on charge differences.

For membrane proteins like full-length SMO, additional considerations include:

  • Use of appropriate detergents or lipid nanodiscs to maintain protein stability and native conformation

  • Addition of stabilizing agents during purification to prevent denaturation

  • Temperature control during expression and purification steps

The storage buffer composition is critical for stability, with successful examples including TBS (pH 7.4) with 1% BSA, 0.02% preservative, and 50% Glycerol .

How can researchers effectively measure SMO activity in chicken models?

Several approaches can be used to measure SMO activity:

  • Phosphorylation Assays: As SMO activation involves phosphorylation by multiple kinases (PKA, CKI, and FU kinase), phosphorylation status can be assessed using phospho-specific antibodies or mass spectrometry .

  • Cellular Localization: SMO trafficking to the primary cilium (in vertebrates) or plasma membrane can be monitored through fluorescence microscopy using tagged constructs .

  • Reporter Assays: Gli-responsive luciferase reporters can measure downstream pathway activation.

  • Binding Assays: To evaluate interactions between SMO and its binding partners using techniques such as co-immunoprecipitation or fluorescence resonance energy transfer (FRET).

  • Functional Readouts: In developmental contexts, measuring outcomes like limb patterning or gene expression changes in response to SMO modulation .

What are the known post-translational modifications of chicken SMO and how do they affect its function?

Key post-translational modifications of SMO include:

  • Phosphorylation: The C-terminal tail of SMO is phosphorylated by multiple kinases including CK1α, PKA, and GRK2 . This phosphorylation induces conformational changes and affects membrane localization. Sequential phosphorylation by PKA, CKI, and FU kinase has been shown to regulate SMO stabilization by promoting recycling rather than degradation after endocytosis .

  • Sumoylation: Though not specifically documented in chicken SMO, studies in Drosophila have demonstrated that the small ubiquitin-related modifier (SUMO) pathway can regulate SMO activity. Knockdown of SUMO pathway components prevents SMO accumulation .

  • Glycosylation: As a membrane protein, SMO undergoes glycosylation in the secretory pathway, which affects its folding and trafficking.

  • Ubiquitination: Regulates SMO degradation and turnover, working in opposition to sumoylation in some contexts .

These modifications create a complex regulatory network that fine-tunes SMO activity in response to Hedgehog ligand concentration and other cellular signals.

How can structural studies of recombinant chicken SMO inform drug development?

Structural studies of chicken SMO can provide valuable insights for drug development through several approaches:

  • Comparative Structural Analysis: Chicken SMO structures can be compared with human SMO to identify conserved binding pockets and species-specific differences. This is particularly valuable for developing drugs with improved specificity and reduced off-target effects.

  • Domain-Specific Studies: The NMR solution structure of the CRD domain has revealed insights into small molecule binding sites . Similar approaches with chicken SMO could identify unique binding characteristics.

  • Structure-Guided Drug Design: Crystal structures of SMO bound to various ligands can guide the development of new inhibitors. For chicken SMO, preparing crosslinked complexes has been used to overcome low-affinity binding interactions for crystallography studies .

  • Resistance Mutation Mapping: Structural studies can help explain how mutations in SMO confer resistance to existing drugs, informing the design of next-generation inhibitors.

  • Conformational Dynamics: Beyond static structures, understanding the dynamic conformational changes of SMO using techniques like hydrogen-deuterium exchange mass spectrometry or NMR can reveal additional druggable states.

What are the challenges in studying chicken SMO interactions with Protein Kinase A and how can they be overcome?

The interaction between chicken SMO and Protein Kinase A presents several research challenges:

  • Low Binding Affinity: The intrinsically low affinity between SMO cytoplasmic tail (SMOct) and PKA-C has hampered structural characterization of the complex .

  • Unstructured Domains: The largely unstructured nature of certain SMO domains makes them difficult to characterize using traditional crystallography or cryoEM approaches.

  • Regulation by Phosphorylation: Understanding how GRK2/3 phosphorylation events regulate the SMO/PKA-C interaction requires sophisticated experimental designs.

These challenges can be addressed through:

  • Chemical Crosslinking: Preparing crosslinked complexes of SMOct/PKA-C for crystallography studies overcomes the low-affinity binding issue .

  • Phosphomimetic Mutations: Engineering SMO constructs with mutations that mimic phosphorylation events to directly test their role in regulating SMO/PKA-C interactions .

  • NMR Spectroscopy: Optimized protocols for isotopically labeled SMOct preparation in E. coli can facilitate NMR studies of this unstructured domain .

  • Advanced Binding Assays: Using techniques with higher sensitivity such as microscale thermophoresis or bioluminescence resonance energy transfer (BRET) to detect and characterize transient interactions.

What are the optimal conditions for testing recombinant chicken SMO in developmental studies?

When designing developmental studies using recombinant chicken SMO:

  • Developmental Timing: Consider the specific developmental stages where SMO activity is critical. For chicken embryo studies, stages HH20-24 have been used successfully for analyzing SMO function in limb development .

  • Delivery Methods:

    • For in ovo experiments, RCAS virus production and microinjection techniques have been used successfully

    • For ex vivo tissue, explant cultures can be maintained in appropriate media

  • Control Conditions: Include proper controls such as:

    • Treatment with Hedgehog pathway inhibitors like cyclopamine (5 mM diluted in DMEM)

    • Removal of Hedgehog-expressing cells for comparison

    • Vehicle controls for drug treatments

  • Analysis Methods:

    • For phenotypic assessment, examine tissue patterning, particularly in structures known to be Hedgehog-dependent

    • For molecular analysis, measure Gli target gene expression

    • For cellular localization, use immunohistochemistry with appropriate antibodies

  • Environmental Parameters: Maintain consistent environmental conditions such as:

    • Temperature (typically 38°C for chicken embryos)

    • Humidity

    • Incubation time (precisely tracked in hours)

How can researchers troubleshoot expression issues with recombinant chicken SMO?

When encountering expression issues with recombinant chicken SMO:

  • Protein Misfolding and Aggregation:

    • Modify expression temperature (try lower temperatures like 16-18°C)

    • Use specialized E. coli strains designed for membrane proteins

    • Include folding enhancers or chaperones

    • For cysteine-rich domains, ensure proper disulfide bond formation through oxidative conditions or disulfide isomerases

  • Low Expression Yields:

    • Optimize codon usage for the expression system

    • Try different fusion tags or signal sequences

    • Adjust induction conditions (inducer concentration, induction time)

    • Test expression of individual domains separately

  • Proteolytic Degradation:

    • Include protease inhibitors during purification

    • Remove protease-sensitive regions or stabilize them through mutations

    • Optimize buffer conditions to minimize degradation

  • Protein Inactivity:

    • Ensure proper post-translational modifications are present

    • Verify correct folding using circular dichroism or limited proteolysis

    • Test multiple buffer conditions for stability and activity

  • Verification Methods:

    • Western blotting with antibodies against SMO or epitope tags to confirm expression

    • Mass spectrometry to verify protein identity and modifications

    • Functional assays to confirm biological activity

How does recombinant chicken SMO compare functionally to SMO from other species in experimental settings?

Comparative analysis of chicken SMO with other species reveals important functional similarities and differences:

SpeciesFunctional SimilaritiesNotable DifferencesExperimental Implications
HumanCore Hedgehog pathway transduction, CRD binding to small moleculesPotentially different pharmacological responses to certain SMO inhibitorsChicken models may not perfectly predict human drug responses
MouseDevelopmental patterning roles, response to Sonic HedgehogPotentially different trafficking kineticsConsider species-specific differences when translating developmental findings
DrosophilaBasic signaling mechanism, regulation by phosphorylationSignificant structural differences, different downstream effectorsDrosophila SMO lacks certain domains present in vertebrate SMO
ZebrafishSimilar developmental rolesDifferences in tissue-specific expression patternsComplementary model for developmental studies

Key comparative findings include:

  • The CRD domain of both Drosophila and human SMO can bind to small molecules like budesonide (Bud), suggesting conserved binding mechanisms across species .

  • Phosphorylation mechanisms are conserved across species, with chicken SMO likely regulated by similar kinases (PKA, CKI) as in other vertebrates .

  • SMO trafficking patterns differ between vertebrates (where SMO localizes to primary cilia) and invertebrates like Drosophila (where SMO traffics to the plasma membrane).

  • When testing across species, researchers should consider that antibodies may show variable cross-reactivity - some antibodies developed against human SMO are predicted to react with chicken SMO as well as dog, cow, pig, horse, and rabbit homologs .

What research questions about chicken SMO remain unexplored compared to mammalian SMO studies?

Several important research questions about chicken SMO remain underexplored:

  • Species-Specific Drug Responses: Systematic comparison of chicken SMO response to known SMO inhibitors and agonists compared to human and mouse homologs. This could reveal unique pharmacological properties and binding sites.

  • Role in Avian-Specific Developmental Processes: How SMO functions in avian-specific features like feather development, beak morphogenesis, and air sac formation.

  • Comparative Post-Translational Modification Patterns: Comprehensive characterization of chicken SMO post-translational modifications and how they differ from mammalian counterparts.

  • Interaction Proteomics: Identification of chicken-specific SMO interacting proteins that may reveal unique regulatory mechanisms.

  • Evolutionary Adaptation: How SMO function has adapted to support unique aspects of avian development and physiology throughout evolution.

  • Alternative Splicing: Characterization of potential chicken-specific SMO splice variants and their functional significance.

  • Tissue-Specific Regulation: Detailed analysis of SMO expression and regulation across different chicken tissues compared to mammalian patterns.

Addressing these questions would significantly advance our understanding of both species-specific and conserved aspects of Hedgehog signaling through SMO.

What are common pitfalls in purifying functional recombinant chicken SMO and how can they be avoided?

Several challenges arise when purifying functional recombinant chicken SMO:

  • Maintaining Structural Integrity:

    • Pitfall: Loss of native conformation during extraction and purification

    • Solution: Use mild detergents appropriate for GPCRs (e.g., DDM, MNG-3) and consider lipid nanodiscs for maintaining a native-like membrane environment

  • Cysteine-Rich Domain (CRD) Misfolding:

    • Pitfall: Incorrect disulfide bridge formation in the CRD, leading to ER retention as observed with cysteine-to-alanine mutants

    • Solution: Include oxidizing agents to promote proper disulfide formation and consider stepwise refolding protocols

  • Aggregation During Concentration:

    • Pitfall: Protein aggregation when concentrating for structural or functional studies

    • Solution: Add stabilizing agents (glycerol, specific lipids) and avoid excessive concentration

  • Loss of Binding Partners:

    • Pitfall: Removal of essential binding partners during purification

    • Solution: Consider co-expression and co-purification approaches for capturing physiologically relevant complexes

  • Proteolytic Degradation:

    • Pitfall: C-terminal region is particularly susceptible to proteolysis

    • Solution: Use protease inhibitor cocktails and maintain cold temperatures throughout purification

  • Verification of Functionality:

    • Pitfall: Purifying structurally intact but functionally inactive protein

    • Solution: Include functional assays such as ligand binding or downstream signaling activation as quality control

How should researchers interpret contradictory data when studying chicken SMO in different experimental contexts?

When faced with contradictory data regarding chicken SMO:

  • Consider Context-Dependent Regulation:

    • SMO may behave differently in different cellular contexts due to varying expression levels of interacting proteins

    • The developmental stage can significantly impact SMO function, as shown in chicken embryo studies at different stages

  • Evaluate Experimental Methods:

    • Different methods for measuring SMO activity (e.g., phosphorylation status vs. downstream target expression) may yield different results

    • In vitro vs. in vivo studies often show discrepancies due to the complex regulatory environment in vivo

  • Assess Technical Variables:

    • Antibody specificity issues can lead to contradictory results

    • Expression levels in overexpression studies may not reflect physiological behavior

  • Reconcile Through Mechanistic Models:

    • Develop working hypotheses that account for seemingly contradictory observations

    • Consider dose-dependent effects, as SMO response to Hedgehog can change based on concentration gradients

  • Comparative Approach:

    • Compare with data from other species to identify conserved vs. species-specific effects

    • Use multiple model systems to triangulate true biological effects

  • Reproducibility Assessment:

    • Evaluate statistical robustness of contradictory findings

    • Consider sample sizes and biological vs. technical replicates in each study

What emerging technologies and approaches will advance chicken SMO research in the next decade?

Several innovative technologies are poised to transform chicken SMO research:

  • Cryo-EM Advances: Improved resolution of cryo-electron microscopy will allow visualization of SMO in different conformational states and in complex with interacting proteins, providing insights into activation mechanisms.

  • AlphaFold and AI-Based Structural Prediction: Computational models will help predict structural features of chicken SMO, particularly in regions that are difficult to characterize experimentally.

  • CRISPR-Based Approaches in Chicken Embryos: More efficient genome editing in chickens will allow precise manipulation of SMO and pathway components in vivo.

  • Organoid Systems: Chicken-derived organoids will provide more physiologically relevant contexts for studying SMO function in development and disease.

  • Single-Cell Technologies: Single-cell transcriptomics and proteomics will reveal cell type-specific responses to SMO activation and inhibition.

  • Advanced Imaging Techniques: Super-resolution microscopy and light sheet microscopy will provide unprecedented visualization of SMO trafficking and localization in developing tissues.

  • Microfluidic Systems: Gradient generators will allow precise control of Hedgehog concentration to study dose-dependent effects on SMO activation.

  • Computational Systems Biology: Mathematical modeling of the Hedgehog pathway will integrate experimental data to predict system-level behaviors.

How might recombinant chicken SMO contribute to understanding evolutionary aspects of Hedgehog signaling?

Recombinant chicken SMO offers unique opportunities for evolutionary studies:

  • Comparative Structural Biology: Comparing structures of SMO across species can reveal conserved functional elements and species-specific adaptations. Chicken SMO represents an important evolutionary position between mammals and non-amniote vertebrates.

  • Functional Conservation Testing: Experiments testing cross-species complementation (e.g., can chicken SMO rescue mammalian SMO mutants?) will identify functionally conserved regions.

  • Regulatory Element Evolution: Studies of how SMO regulation has evolved could reveal how changes in signaling dynamics contributed to morphological innovations during vertebrate evolution.

  • Domain-Specific Evolutionary Rates: Analysis of evolutionary rates across different SMO domains can identify regions under different selective pressures.

  • Ligand-Receptor Co-evolution: Examining how SMO and its binding partners (both upstream regulators and downstream effectors) have co-evolved will provide insights into signaling network evolution.

  • Developmental System Drift: Investigating how similar developmental outcomes are achieved despite evolutionary changes in signaling components can reveal principles of developmental system drift.

  • Ancient Protein Reconstruction: Techniques to reconstruct ancestral SMO proteins could reveal how SMO function has changed over evolutionary time and potentially identify the ancestral state of Hedgehog signaling.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.