Recombinant Chicken Sodium/potassium-transporting ATPase subunit beta-1 (ATP1B1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference in the order notes and we will fulfill it to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for precise delivery details.
Note: Our standard shipping includes normal blue ice packs. If dry ice shipping is required, please contact us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a final concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a reference point.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We aim to deliver the tag type determined during production. If you have a specific tag type preference, please inform us and we will prioritize its development.
Synonyms
ATP1B1; Sodium/potassium-transporting ATPase subunit beta-1; Sodium/potassium-dependent ATPase subunit beta-1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-305
Protein Length
full length protein
Species
Gallus gallus (Chicken)
Target Names
Target Protein Sequence
MARGKANDGDGNWKKFIWNSEKKELLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLTVSEFEPKYQDRVAPPGLTQVPQVQKTEISFTVNDPKSYDPYVKNLEGFLNKYSAGEQTDNIVFQDCGDIPTDYKERGPYNDAQGQKKVCKFKREWLENCSGLQDNTFGYKDGKPCILVKLNRIIGFKPKAPENESLPSDLAGKYNPYLIPVHCVAKRDEDADKIGMVEYYGMGGYPGFALQYYPYYGRLLQPQYLQPLVAVQFTNLTYDVEVRVECKEYGQNIQYSDKDRFQGRFDIKFDIKSS
Uniprot No.

Target Background

Function
This protein represents the non-catalytic component of the active enzyme, which catalyzes the hydrolysis of ATP in conjunction with the exchange of Na(+) and K(+) ions across the plasma membrane. The beta subunit regulates the number of sodium pumps transported to the plasma membrane by influencing the assembly of alpha/beta heterodimers.
Database Links
Protein Families
X(+)/potassium ATPases subunit beta family
Subcellular Location
Cell membrane; Single-pass type II membrane protein.

Q&A

What is ATP1B1 and what is its functional role in Na+/K+ ATPase activity?

ATP1B1 is the beta-1 subunit of Na+/K+ ATPase responsible for the formation and structural integrity of the entire Na+/K+ ATPase complex . Though non-catalytic in nature, this subunit is essential for the proper functioning of the enzyme. The Na+/K+ ATPase catalyzes ATP hydrolysis coupled with the exchange of Na+ and K+ ions across the cytomembrane . This transport activity establishes and maintains electrochemical gradients across plasma membranes, which are necessary for:

  • Osmoregulation in tissues

  • Electrical excitability of nerve and muscle cells

  • Sodium-coupled transport of various organic and inorganic molecules

  • Cell adhesion processes

  • Establishing cell polarity in epithelial tissues

The chicken ATP1B1 protein consists of 303 amino acids with a single transmembrane domain, making it a type I membrane protein with most of its mass residing in the extracellular domain .

How does ATP1B1 expression vary across chicken tissues, and what are the implications for tissue-specific research?

ATP1B1 demonstrates broad expression patterns across multiple chicken tissues, with particularly notable expression in:

  • Kidney tissues

  • Brain tissues

  • Heart tissues

  • Skeletal muscle

  • Uterine tissue (particularly in laying hens)

Differential expression analysis reveals that ATP1B1 is among several ATPase genes showing significant expression changes in the chicken uterus during egg-laying periods compared to non-laying periods . This tissue-specific regulation suggests specialized roles in different physiological processes, including potential involvement in calcium transport mechanisms during eggshell formation.

When designing tissue-specific research, investigators should consider using appropriate positive controls for expression studies, as antibody testing has confirmed detectable ATP1B1 protein in mouse brain tissue, human heart tissue, human brain tissue, and mouse heart tissue .

What are the optimal conditions for expressing recombinant chicken ATP1B1 in heterologous systems?

Successful expression of recombinant chicken ATP1B1 requires careful consideration of expression systems and conditions:

Expression Systems Comparison:

  • Mammalian expression systems: HEK-293 cells have been successfully used for ATP1B1 expression as demonstrated by positive immunofluorescence results . These systems provide appropriate post-translational modifications and trafficking machinery.

  • Bacterial expression systems: May be used for partial domains but often struggle with full-length membrane proteins due to folding issues.

  • Insect cell systems: Offer a good compromise between correct folding and higher yields.

Critical Parameters for Expression:

  • Include the complete coding sequence (303 amino acids)

  • Optimize codon usage for the host expression system

  • Consider fusion tags that won't interfere with the single transmembrane domain

  • Co-express with alpha subunits when studying functional properties

  • Include appropriate chaperones to ensure correct folding

For functional studies, co-expression with the alpha subunit is essential, as beta subunits alone will not exhibit enzymatic activity.

What are the recommended antibody-based detection methods for chicken ATP1B1 in various applications?

Based on validated antibody performance data, researchers should consider the following application-specific recommendations:

ApplicationRecommended DilutionValidated Tissue/Cell TypesNotes
Western Blot (WB)1:1000-1:8000Mouse brain, human heart, human brain, mouse heartObserved molecular weight: 45-52 kDa
Immunoprecipitation (IP)0.5-4.0 μg per 1-3 mg total proteinMouse brain tissueOptimized for tissue lysates
Immunohistochemistry (IHC)1:20-1:200Human brain, human skeletal muscleRecommended antigen retrieval with TE buffer pH 9.0
Immunofluorescence (IF/ICC)1:10-1:100HEK-293 cellsUseful for subcellular localization studies

Important considerations for antibody-based detection:

  • Expected molecular weight may vary (45-52 kDa observed vs. 35 kDa calculated) due to glycosylation and other post-translational modifications

  • Sample-dependent optimization is necessary for each application

  • Species cross-reactivity has been confirmed for human and mouse samples, with reported reactivity in rat samples as well

How should researchers troubleshoot unexpected molecular weight observations in ATP1B1 detection?

The calculated molecular weight for ATP1B1 is approximately 35 kDa, but empirical observations consistently show bands at 45-52 kDa in Western blots . This discrepancy is not an experimental error but reflects biological reality due to:

  • Post-translational modifications, particularly glycosylation of the extracellular domain

  • Species-specific differences in modification patterns

  • Tissue-specific glycosylation variations

When troubleshooting unexpected molecular weight observations:

  • Validation approach: Compare observed bands with positive controls from tissues known to express ATP1B1 (brain, heart)

  • Enzymatic deglycosylation: Treat samples with PNGase F or similar enzymes to remove N-linked glycans and confirm the core protein size

  • Different detergents: Test various detergents for membrane protein extraction that may affect migration patterns

  • Sample heating: Excessive heating can cause membrane protein aggregation; optimize sample preparation temperatures

  • Cross-reactivity check: Verify antibody specificity using knockout controls or competing peptides

What is the role of ATP1B1 in avian reproductive physiology, particularly in eggshell formation?

RNA sequencing analysis of laying hen uteri has revealed significant insights into ATP1B1's potential role in avian reproduction:

  • ATP1B1 is part of a network of differentially expressed ATPase genes in the chicken uterus during the egg-laying cycle, including:

    • ATPase Na+/K+ transporting subunit alpha 1 (ATP1A1)

    • ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 3 (ATP2A3)

    • ATPase Na+/K+ transporting subunit beta 1 (ATP1B1)

    • ATPase plasma membrane Ca2+ transporting 2 (ATP2B2)

    • ATPase secretory pathway Ca2+ transporting 2 (ATP2C2)

  • These transport proteins likely contribute to the precise regulation of ion fluxes necessary for eggshell mineralization, particularly calcium transport.

  • The interrelated network of differentially expressed genes suggests ATP1B1 functions as part of a coordinated system regulating the ionic environment during shell formation.

  • Research examining the temporal expression patterns during the egg-laying cycle could reveal critical periods of ATP1B1 function.

Methodological approaches for studying ATP1B1 in reproductive contexts should include:

  • Stage-specific sampling across the egg-laying cycle

  • Correlation of ATP1B1 expression with shell quality parameters

  • In situ hybridization to localize expression within specific cell types

  • Functional inhibition studies to assess direct contributions to shell formation

How can researchers effectively study the interaction between ATP1B1 and alpha subunits in functional Na+/K+ ATPase complexes?

Studying the interaction between ATP1B1 and alpha subunits requires specialized approaches:

  • Co-immunoprecipitation (Co-IP):

    • Use validated antibodies (0.5-4.0 μg per 1-3 mg of total protein)

    • Extract protein in detergents that maintain protein-protein interactions

    • Confirm subunit association by Western blot detection of both alpha and beta subunits

  • Förster Resonance Energy Transfer (FRET):

    • Tag alpha and beta subunits with appropriate fluorophores

    • Express in mammalian cells (HEK-293 validated for ATP1B1 expression)

    • Monitor interaction through energy transfer between fluorophores

  • Bimolecular Fluorescence Complementation (BiFC):

    • Split fluorescent protein between alpha and beta subunits

    • Reconstitution of fluorescence indicates interaction

    • Observe subcellular localization of the complex

  • Functional assay development:

    • Measure Na+/K+ ATPase activity with purified recombinant proteins

    • Assess how mutations in ATP1B1 affect complex formation and enzyme activity

    • Characterize kinetic parameters with various combinations of alpha and beta isoforms

The non-catalytic nature of ATP1B1 makes it particularly important to study in the context of the complete enzyme complex rather than in isolation.

What are the structural and functional differences between avian and mammalian ATP1B1?

Comparative analysis of chicken and mammalian ATP1B1 reveals important similarities and differences:

Structural Characteristics:

  • The human ATP1B1 protein has 303 amino acids, identical in length to the chicken ortholog

  • Both contain a single transmembrane domain

  • The extracellular domain contains conserved cysteine residues important for disulfide bonding

  • Glycosylation patterns may differ between species, contributing to the observed molecular weight differences

Functional Implications:

  • Basic ion transport mechanisms are conserved across species

  • Species-specific interactions with alpha subunits may influence kinetic properties

  • Tissue distribution shows some conservation, with expression in brain, kidney and heart tissues across species

  • Specialized roles in avian reproductive tissues may represent evolutionary adaptations specific to egg-laying species

When conducting cross-species research or using mammalian models to study avian ATP1B1 function, researchers should be aware that antibodies raised against human ATP1B1 (such as 15192-1-AP) demonstrate cross-reactivity with mouse samples and potentially with chicken samples as well .

How do post-translational modifications affect ATP1B1 function, and how do these modifications differ across species?

Post-translational modifications (PTMs) significantly impact ATP1B1 function across species:

Major PTMs Affecting ATP1B1:

  • N-linked glycosylation:

    • Contributes to the discrepancy between calculated (35 kDa) and observed (45-52 kDa) molecular weights

    • Influences protein folding, trafficking, and surface stability

    • May vary in pattern and extent between avian and mammalian species

  • Phosphorylation:

    • Regulates interaction with alpha subunits

    • May respond differently to signaling pathways across species

    • Can be studied using phospho-specific antibodies or mass spectrometry

  • Palmitoylation:

    • Affects membrane microdomain localization

    • Influences interaction with associated proteins

    • May show species-specific patterns

Methodological Approaches for PTM Research:

  • Mass spectrometry analysis of purified ATP1B1 to identify and compare modification sites

  • Site-directed mutagenesis of potential modification sites

  • Treatment with inhibitors of specific modifications to assess functional impact

  • Comparative analysis across species using bioinformatic prediction tools

Understanding these species-specific differences in PTMs is crucial when developing and interpreting experimental models based on recombinant chicken ATP1B1.

What are the most common challenges in recombinant ATP1B1 expression, and how can they be addressed?

Researchers frequently encounter several challenges when working with recombinant ATP1B1:

ChallengeProbable CauseSolution
Low expression yieldToxicity to host cells, inefficient translationUse inducible expression systems, optimize codon usage, lower expression temperature
Protein misfoldingAbsence of proper chaperones, rapid expression rateCo-express with chaperones, reduce inducer concentration, express at lower temperatures
Improper membrane insertionHydrophobic transmembrane domain, signal sequence issuesUse specialized membrane protein expression vectors, optimize signal sequence
Lack of functional activityExpression without alpha subunitCo-express with appropriate alpha subunit
Aggregation during purificationDetergent incompatibility, inappropriate buffer conditionsScreen multiple detergents, add stabilizing agents, optimize buffer composition

When troubleshooting expression issues, a systematic approach comparing different expression systems, induction conditions, and purification methods is recommended. For functional studies, always confirm proper assembly with alpha subunits using techniques like co-immunoprecipitation before conducting activity assays.

How should researchers design experiments to study ATP1B1's role in tissue-specific functions?

When investigating ATP1B1's tissue-specific functions, especially in avian systems:

  • Tissue Selection and Preparation:

    • Target tissues with confirmed expression (brain, heart, kidney, and uterus in laying hens)

    • Compare tissues at different physiological states (e.g., laying vs. non-laying hens)

    • Consider developmental timepoints for embryonic studies

  • Expression Analysis:

    • Quantitative RT-PCR with appropriate reference genes (TBP has been validated as stable in uterine tissues)

    • Western blotting with tissue-specific positive controls

    • Immunohistochemistry for cellular localization within tissues

  • Functional Studies:

    • Primary cell cultures from specific tissues

    • Ex vivo tissue preparations with pharmacological manipulation

    • In vivo studies with tissue-specific genetic manipulation

  • Data Analysis Considerations:

    • Account for physiological state (reproductive cycle, age, health status)

    • Use appropriate statistical models for tissue comparison

    • Consider interaction effects with other ATPase family members

For research specifically focusing on ATP1B1's role in avian reproduction, the RNA-seq approach used in analyzing differential expression between laying and non-laying hens provides a powerful methodological template .

What are the emerging techniques that may advance our understanding of ATP1B1 function in avian systems?

Several cutting-edge approaches show promise for elucidating ATP1B1 function:

  • CRISPR/Cas9 genome editing:

    • Generate tissue-specific knockouts or mutations

    • Create tagged endogenous proteins for localization studies

    • Introduce human disease-associated mutations into chicken ATP1B1

  • Cryo-electron microscopy:

    • Determine high-resolution structures of chicken Na+/K+ ATPase complexes

    • Compare structural differences between mammalian and avian complexes

    • Visualize conformational changes during transport cycle

  • Single-molecule techniques:

    • Measure real-time transport activity of individual ATP1B1-containing complexes

    • Study association/dissociation dynamics with alpha subunits

    • Track membrane diffusion and clustering behavior

  • Spatial transcriptomics and proteomics:

    • Map expression patterns with cellular resolution

    • Identify tissue-specific interacting partners

    • Correlate with physiological states such as egg-laying cycles

These advanced techniques will help bridge the current knowledge gaps in understanding species-specific functions of ATP1B1 in specialized avian physiological processes like eggshell formation.

How can integrated multi-omics approaches enhance our understanding of ATP1B1 in avian physiological systems?

Integrated multi-omics approaches offer powerful insights into ATP1B1 function:

  • Combined transcriptomics and proteomics:

    • Correlate mRNA and protein expression levels across tissues

    • Identify post-transcriptional regulation mechanisms

    • Compare with differentially expressed genes identified in laying hen studies

  • Integration with phosphoproteomics:

    • Map phosphorylation events on ATP1B1 and interacting proteins

    • Identify kinase networks regulating ATP1B1 function

    • Correlate with physiological states and stimuli

  • Metabolomics correlation:

    • Link ATP1B1 activity to metabolic pathways

    • Identify biomarkers of altered ATP1B1 function

    • Correlate with egg quality parameters in laying hens

  • Systems biology modeling:

    • Develop predictive models of Na+/K+ ATPase function in different tissues

    • Simulate effects of ATP1B1 mutations or expression changes

    • Model interaction networks with other ion transport systems

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.