Recombinant Chicken Sodium/potassium-transporting ATPase subunit beta-3 (ATP1B3)

Shipped with Ice Packs
In Stock

Description

Introduction to Sodium/potassium-transporting ATPase

Na+/K+-ATPase is a plasma membrane pump with numerous physiological functions, catalyzing the hydrolysis of ATP coupled with the exchange of sodium and potassium ions across the plasma membrane . This enzyme system is essential for establishing and maintaining electrochemical gradients, which are fundamental to various cellular processes including osmoregulation, sodium-coupled transport of organic and inorganic molecules, and electrical excitability of nerve and muscle tissues . The beta-3 subunit (ATP1B3) represents a critical non-catalytic component of this enzyme complex, contributing to its formation and structural integrity .

The ATP1B3 Protein Family

ATP1B3 belongs to the broader family of Na+/K+ and H+/K+ ATPases beta chain proteins . These proteins are integral membrane components widely distributed across species, from prokaryotes to complex eukaryotes . While the catalytic alpha subunits of these enzymes have been extensively studied, the exact functions of the non-catalytic beta subunits, including ATP1B3, remain less well defined despite their essential role in proper enzyme function .

Significance in Avian Physiology

The chicken (Gallus gallus) ATP1B3 represents an important subject for comparative studies of ion transport mechanisms across species. Understanding the structure and function of chicken ATP1B3 contributes valuable insights into avian physiology and potential evolutionary adaptations in ion transport mechanisms. Recent genomic analyses of indigenous chickens have highlighted the importance of studying such proteins in the context of adaptation to various environmental conditions .

Protein Structure and Domains

While the search results don't provide the complete amino acid sequence specifically for chicken ATP1B3, we can infer its general structure based on the human homolog. The human ATP1B3 features 279 amino acids with a single transmembrane domain . By comparison, other Na+/K+-ATPase beta subunits typically contain an extracellular domain folding into an immunoglobulin-like structure . This structural arrangement is likely conserved in the chicken homolog, given the functional importance of these domains for proper enzyme assembly and activity.

Comparative Analysis with Human ATP1B3

The table below summarizes key comparative characteristics between human and chicken ATP1B3 based on available information:

CharacteristicHuman ATP1B3Chicken ATP1B3
Gene NameATP1B3ATP1B3
AliasesSodium/potassium-dependent ATPase subunit beta-3, CD298, ATPB-3Sodium/potassium-dependent ATPase subunit beta-3
FunctionNon-catalytic component of Na+/K+-ATPaseNon-catalytic component of Na+/K+-ATPase
Protein Length279 amino acidsNot specifically reported
Transmembrane Domains1Presumably 1 (based on homology)
Chromosome Location3q23 (with pseudogene on chromosome 2)Not specifically reported

While specific structural information for chicken ATP1B3 is limited in the provided search results, the functional conservation across species suggests significant structural similarities between the human and chicken proteins .

Recombinant Protein Production and Characteristics

The production of recombinant chicken ATP1B3 involves several expression systems and purification methods to obtain functional protein for research applications.

Expression Systems

Recombinant chicken ATP1B3 can be produced using various expression hosts, including:

  • Escherichia coli (E. coli)

  • Yeast

  • Baculovirus-infected insect cells

  • Mammalian cell lines

Each expression system offers distinct advantages depending on the intended application, with bacterial systems generally providing higher yield but potentially lacking some post-translational modifications, while mammalian systems offer more native-like protein processing at the cost of lower yields.

Purification and Quality Assessment

Commercially available recombinant chicken ATP1B3 typically achieves a purity level greater than or equal to 85% as determined by sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE) . This method separates proteins based on molecular weight and is widely used to assess protein purity. The purification process likely employs affinity chromatography utilizing tags engineered into the recombinant protein, followed by additional purification steps to achieve the reported purity levels.

Recombinant Protein Variants

Multiple variants of recombinant chicken ATP1B3 are available for research purposes, including:

  1. Full-length recombinant chicken ATP1B3

  2. Partial recombinant chicken ATP1B3 (containing specific functional domains)

These variants allow researchers to study particular aspects of the protein's function or to optimize expression for specific experimental purposes.

Functional Properties of ATP1B3

The ATP1B3 subunit serves critical roles within the Na+/K+-ATPase enzyme complex, contributing to both its structure and function.

Role in Na+/K+-ATPase Complex

ATP1B3 functions as the non-catalytic component of the active Na+/K+-ATPase enzyme . While it does not directly participate in the catalytic process, it plays essential roles in:

  • Ensuring proper assembly of the enzyme complex

  • Maintaining structural integrity of the Na+/K+ ATPase holoenzyme

  • Supporting the catalytic activity of the alpha subunit

  • Potentially regulating enzyme localization and stability

The active enzyme catalyzes ATP hydrolysis coupled with the exchange of Na+ and K+ ions across the plasma membrane, creating electrochemical gradients essential for numerous cellular functions .

Potential Functional Significance

While the exact function of the chicken ATP1B3 subunit has not been fully characterized in the provided search results, insights from human ATP1B3 research suggest potential roles beyond structural support. Human ATP1B3 has been implicated in:

  • Lymphocyte activity regulation

  • Cytokine production (including IFN-γ, IL-2, IL-4, and IL-10)

  • Antiviral responses

Whether these immunomodulatory functions are conserved in chicken ATP1B3 remains to be determined through comparative functional studies.

Applications in Research and Biotechnology

Recombinant chicken ATP1B3 serves as a valuable tool in various research applications, contributing to our understanding of fundamental biological processes and potential therapeutic developments.

Research Applications

The recombinant protein enables investigations into:

  • Structure-function relationships of Na+/K+-ATPase in avian systems

  • Comparative studies of ion transport mechanisms across species

  • Development of antibodies and detection systems for ATP1B3

  • Analysis of protein-protein interactions involving ATP1B3

Diagnostic and Analytical Tools

Recombinant chicken ATP1B3 serves as a standard for the development and validation of analytical tools including:

  • ELISA (enzyme-linked immunosorbent assay) kits for ATP1B3 detection

  • Antibodies conjugated with various detection moieties (HRP, FITC) for immunological applications

  • Protein interaction studies to identify binding partners

These tools facilitate research into the expression patterns and functional significance of ATP1B3 in normal and pathological states.

Comparative Genomics Applications

The study of chicken ATP1B3 contributes to broader genomic analyses examining selective signatures and genes involved in adaptation. Genomic sequencing and analysis methods, including those used for chicken genome studies, can identify variations in the ATP1B3 gene that might correlate with specific phenotypic traits or adaptations . Such studies utilize techniques like Burrows-Wheeler Alignment and GATK for SNP calling to identify genetic variations across chicken populations .

Future Research Directions

Despite the available information on recombinant chicken ATP1B3, significant knowledge gaps remain to be addressed through future research.

Functional Characterization

While ATP1B3 is known to be a non-catalytic component of Na+/K+-ATPase, its exact contributions to enzyme function in chicken tissues warrant further investigation. Potential areas for exploration include:

  • Tissue-specific expression patterns

  • Developmental regulation

  • Response to physiological challenges such as osmotic stress

  • Potential roles in avian immune responses, based on findings from human ATP1B3 studies

Biotechnological Applications

The development of chicken-specific ATP1B3 detection systems could facilitate research in poultry science and veterinary medicine. Additionally, if chicken ATP1B3 shares the immunomodulatory properties observed in human ATP1B3, it might represent a target for interventions aimed at enhancing disease resistance in poultry.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
ATP1B3; Sodium/potassium-transporting ATPase subunit beta-3; Sodium/potassium-dependent ATPase subunit beta-3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-280
Protein Length
full length protein
Species
Gallus gallus (Chicken)
Target Names
Target Protein Sequence
MSKETKKPFRQSVAEWRQFVYNPNSGEFLGRTAKSWGLILLFYLVFYGFLAALFTFTMWVMLQTLSNDIPKYRDRISSPGLMISPKPDTALEFYFNKSDAQSYAEYVSTLRKFLETYDDSKQSQNINCTPGKVFDQNDVAVKKACRFNLSELGQCSGKEDKTFGYSKGTPCVLVKMNRIIGLKPEGEPYIQCTSKEPGAVEINYFPSGGLIDLMYFPYYGKTLHAHYLQPLVAVQLAINSNSTNEEIAIECKILGSPNLKNEDDRDKFLGRIAFKVEMTE
Uniprot No.

Target Background

Function
This subunit is the non-catalytic component of the active enzyme, which catalyzes the hydrolysis of ATP coupled with the exchange of Na(+) and K(+) ions across the plasma membrane. The precise function of the beta-3 subunit is currently unknown.
Database Links
Protein Families
X(+)/potassium ATPases subunit beta family
Subcellular Location
Cell membrane; Single-pass type II membrane protein.
Tissue Specificity
Predominantly expressed in brain.

Q&A

What is chicken ATP1B3 and what are its primary functions?

Chicken ATP1B3 (Sodium/potassium-transporting ATPase subunit beta-3) is a critical beta subunit of the Na+/K+-ATPase enzyme complex encoded by the ATP1B3 gene (GenBank accession NM_205535.1) . The protein belongs to the family of Na+/K+ and H+/K+ ATPases beta chain proteins, which function as plasma membrane pumps with diverse physiological roles . ATP1B3 is primarily responsible for the formation and structural integrity of the Na+/K+-ATPase holoenzyme, which establishes and maintains the electrochemical gradients of Na+ and K+ ions across the plasma membrane .

The primary functions of chicken ATP1B3 include:

  • Contributing to osmoregulation mechanisms

  • Supporting sodium-coupled transport of various organic and inorganic molecules

  • Maintaining electrical excitability in nerve and muscle tissues

  • Potentially participating in cell adhesion processes via its C-terminal immunoglobulin-like domain

Research has demonstrated that ATP1B3 plays additional roles in immune regulation by up-regulating lymphocyte activity and promoting the production of cytokines including IFN-γ, IL-2, IL-4, and IL-10, suggesting potential applications as a therapeutic target in viral infections .

How is the ATP1B3 gene characterized in chickens?

The chicken ATP1B3 gene spans 846 base pairs and encodes the beta-3 subunit of the Na+/K+-ATPase complex . While the human ATP1B3 gene is mapped to chromosome 3q23 with a pseudogene located on chromosome 2, the chicken gene has distinct genomic organization appropriate to avian species . The gene contains specific regulatory elements that control its expression in various tissues.

When amplifying the chicken ATP1B3 gene for research applications, specific primers have been designed and validated:

  • Forward primer: 5′-ATGAGCAAGGAGACGAAGAAG-3′

  • Reverse primer: 5′-TCACTATTCAGTCATCTCAACTTTGAAGGC-3′

For quantitative analysis of ATP1B3 expression, researchers have successfully utilized the following qRT-PCR primers:

  • Forward primer: 5′-ATGAGCAAGGAGACGAAGAAGC-3′

  • Reverse primer: 5′-CCGCGAGGAAGCCATAAAAT-3′

These primers produce an amplicon of 154 bp, making them suitable for real-time PCR applications in studying ATP1B3 expression patterns across different experimental conditions.

What are the established methods for cloning and expressing recombinant chicken ATP1B3?

The established protocol for cloning and expressing recombinant chicken ATP1B3 involves several critical steps:

  • Source tissue selection: Chicken embryo kidney (CEK) cells have been successfully used as a source for ATP1B3 isolation . These cells are typically prepared from 20-day-old specific-pathogen-free (SPF) chicken embryos, with kidneys trypsinized at 37°C for 30 minutes.

  • RNA extraction and cDNA synthesis: Total RNA is extracted using commercially available kits such as Ultrapure RNA Kit, followed by reverse transcription to obtain cDNA using appropriate reverse transcriptases .

  • PCR amplification: The ATP1B3 gene is amplified using specific primers (as mentioned in section 1.2) with an annealing temperature of approximately 50°C .

  • Cloning vector selection: For expression studies, ATP1B3 has been successfully cloned into various vectors including:

    • pDsRed for fluorescent protein fusion applications

    • pcDNA3.1-Myc for mammalian expression with epitope tagging

  • Expression systems: Both HEK293T cells and avian cell lines (such as DF-1) have been documented as effective systems for recombinant chicken ATP1B3 expression .

For optimal expression, cells are typically cultured in appropriate media (DMEM supplemented with 10% FBS for HEK293T and DF-1 cells, or M199 medium with 5% FBS for CEK cells) at 37°C in a 5% CO₂ incubator .

What analytical techniques are most effective for studying ATP1B3 protein interactions?

Several analytical techniques have demonstrated efficacy in studying ATP1B3 protein interactions:

  • Yeast Two-Hybrid (Y2H) System: This approach has been effectively used to screen for proteins that interact with various targets and could be applied to ATP1B3 studies . The system involves:

    • Construction of cDNA libraries from relevant tissues

    • Transformation into yeast strains

    • Selection on appropriate dropout media

    • Confirmation of positive interactions

  • Co-Immunoprecipitation (Co-IP): This is a gold-standard technique for validating protein-protein interactions involving ATP1B3 . The protocol typically involves:

    • Co-transfection of cells with tagged ATP1B3 (e.g., pcDNA3.1-ATP1B3-Myc) and potential interaction partners

    • Cell lysis using appropriate buffers (e.g., RIPA buffer)

    • Immunoprecipitation using antibody-conjugated magnetic beads

    • Western blotting for detection of co-precipitated proteins

  • Fluorescence microscopy: Utilizing tagged versions of ATP1B3 (such as ATP1B3-DsRed fusions) allows for visualization of subcellular localization and co-localization with potential interaction partners .

  • Bioinformatic analysis: Tools such as STRING database and DAVID facilitate functional analysis of ATP1B3 interactions, including GO term enrichment and pathway analysis .

For validating the quality of interaction data, multiple complementary approaches are recommended, with Co-IP serving as the confirmatory technique after initial screening methods.

How is ATP1B3 expression regulated in different chicken tissues?

ATP1B3 expression varies across chicken tissues with distinct regulatory mechanisms:

  • Tissue-specific expression patterns: While comprehensive chicken tissue expression atlases for ATP1B3 are still being developed, research indicates significant expression in kidney tissues, which has made them a preferred source for ATP1B3 isolation and study .

  • Cell density-dependent regulation: Evidence suggests that the quantity of ATP1B3 in the plasma membrane is mediated by cell density . This regulatory mechanism implies potential roles in:

    • Contact inhibition processes

    • Cell-cell adhesion functions

    • Tissue architecture maintenance

  • Transcriptional regulation: Analysis of the ATP1B3 promoter region reveals binding sites for several transcription factors, suggesting complex regulatory control that responds to various physiological and environmental signals.

  • Post-translational modifications: The ATP1B3 protein undergoes several modifications that affect its stability, localization, and function, including glycosylation patterns that may vary across tissues.

When studying ATP1B3 expression, it is recommended to use qRT-PCR with the validated primers mentioned previously, with β-actin serving as an appropriate internal reference gene for standardization .

What factors influence the structural stability of recombinant ATP1B3 in experimental systems?

Several critical factors influence the structural stability of recombinant ATP1B3 in experimental systems:

  • Expression system selection: Different expression systems (bacterial, insect, mammalian) produce variations in post-translational modifications that affect ATP1B3 stability. Mammalian expression systems like HEK293T cells provide more native-like modifications for optimal structural integrity .

  • Buffer composition: The stability of purified ATP1B3 is significantly influenced by:

    • pH (optimal range typically 7.0-7.5)

    • Ionic strength (physiological salt concentrations)

    • Presence of stabilizing agents (glycerol, specific detergents for membrane proteins)

  • Temperature considerations: ATP1B3, being a membrane-associated protein, is sensitive to temperature fluctuations during purification and storage. Maintaining samples at 4°C during processing and -80°C for long-term storage helps preserve structural integrity.

  • Association with alpha subunits: Research indicates that beta subunits of Na+/K+-ATPase, including ATP1B3, achieve maximal stability when co-expressed with appropriate alpha subunits, as they form a functional heterodimeric complex in vivo.

  • Detergent selection: For structural studies of ATP1B3, the choice of detergent is critical:

    • Mild non-ionic detergents (DDM, LMNG) better preserve native structure

    • Detergent concentration must be maintained above CMC (critical micelle concentration)

    • Detergent exchange may be necessary for different experimental applications

Monitoring protein stability through techniques such as thermal shift assays, limited proteolysis, and dynamic light scattering provides valuable data on optimal conditions for maintaining ATP1B3 structural integrity.

How does ATP1B3 contribute to viral infection mechanisms in avian systems?

ATP1B3 plays multifaceted roles in viral infection mechanisms in avian systems:

  • Antiviral activity: Research demonstrates that ATP1B3 can repress Enterovirus 71 (EV71) replication by promoting the production of type-I interferons . Experimental evidence shows:

    • Knockdown of ATP1B3 enhances EV71 replication

    • Overexpression of ATP1B3 represses EV71 replication in susceptible cells

  • Interactions with viral proteins: Studies have investigated ATP1B3 as a potential interaction partner with viral components, such as the non-structural protein 2 (Nsp2) of Infectious Bronchitis Virus (IBV) . These interactions may:

    • Facilitate or inhibit viral replication processes

    • Affect viral protein localization within infected cells

    • Modulate host immune responses

  • Immune modulation: ATP1B3 up-regulates lymphocyte activity and promotes the production of multiple cytokines including IFN-γ, IL-2, IL-4, and IL-10 . This immune-modulatory capacity positions ATP1B3 as:

    • A potential regulator of host immune responses to viral infection

    • A mediator of inflammation during infection

    • A target for therapeutic intervention

  • BST-2 regulation: ATP1B3 functions as a co-factor that accelerates BST-2 degradation, potentially reducing BST-2-mediated restriction of viral production and NF-κB activation . This mechanism has implications for:

    • HIV-1 infection models

    • Potentially other enveloped viruses in avian systems

    • Cellular innate immune responses

The complex role of ATP1B3 in viral infections positions it as both a potential therapeutic target and a marker for monitoring infection progression in avian systems.

What experimental approaches reveal ATP1B3 function in immune regulation?

Multiple experimental approaches have been employed to elucidate ATP1B3's role in immune regulation:

  • Gene silencing techniques:

    • RNA interference (siRNA) targeting ATP1B3 has revealed its impact on immune response genes

    • When ATP1B3 is silenced, increased expression of BST-2 occurs on the cell surface, indicating ATP1B3's role in regulating this important immune mediator

  • Overexpression studies:

    • Transfection with ATP1B3 expression constructs demonstrates effects on cytokine production

    • Standardized protocols utilize pcDNA3.1-based vectors with appropriate epitope tags for detection

  • Cytokine profiling:

    • ELISA and multiplex cytokine assays quantify the impact of ATP1B3 manipulation on:

      • IFN-γ, IL-2, IL-4, and IL-10 production

      • Type-I interferon responses

      • Pro-inflammatory mediators

  • Co-immunoprecipitation assays:

    • Co-IP using antibody-coupled magnetic beads reveals physical interactions between ATP1B3 and immune regulatory proteins

    • Standardized protocol includes:

      • Cell lysis with RIPA buffer

      • Overnight incubation with antibody-conjugated beads at 4°C

      • Thorough washing with TBST buffer

      • SDS-PAGE separation and Western blotting analysis

  • Quantitative PCR analysis:

    • qRT-PCR using validated primers monitors expression changes in ATP1B3 and immune-related genes

    • The 2^(-ΔΔCT) method quantifies fold changes in mRNA expression

    • β-actin serves as an appropriate internal reference gene

Experimental ApproachKey ParametersExpected OutcomesApplications
siRNA Knockdown50-100 nM siRNA, 24-48h post-transfection↑ BST-2 expression, ↑ viral replicationMechanism studies
Overexpression1-2 μg plasmid DNA per 10^6 cells↓ viral replication, ↑ cytokine productionFunctional validation
qRT-PCRATP1B3-F: 5′-ATGAGCAAGGAGACGAAGAAGC-3′ ATP1B3-R: 5′-CCGCGAGGAAGCCATAAAAT-3′Quantitative expression profileExpression studies
Co-IPAnti-Myc or anti-Flag antibodies, magnetic beadsProtein-protein interaction dataInteraction mapping

These methodological approaches provide complementary data on ATP1B3's role in immune regulation, particularly in the context of viral infections in avian systems.

How can structural analysis of ATP1B3 inform therapeutic development?

Structural analysis of ATP1B3 provides critical insights for therapeutic development through multiple approaches:

  • Immunoglobulin-like domain characterization: The C-terminal portion of ATP1B3 folds into an immunoglobulin-like domain that may mediate cell adhesion functions . Structural characterization of this domain through techniques such as X-ray crystallography or cryo-EM can reveal:

    • Binding interfaces for protein-protein interactions

    • Potential sites for targeted therapeutic intervention

    • Structural elements that contribute to immune regulation

  • Interaction interface mapping: Molecular docking simulations combined with experimental validation can identify critical residues involved in:

    • ATP1B3 interaction with viral proteins

    • Association with immune regulatory molecules

    • Binding to alpha subunits in the Na+/K+-ATPase complex

  • Post-translational modification sites: Identification of glycosylation, phosphorylation, and other modification sites through mass spectrometry informs:

    • Regions essential for protein stability

    • Regulatory mechanisms affecting ATP1B3 function

    • Potential targets for modulating ATP1B3 activity

  • Structure-based drug design: High-resolution structural data enables:

    • Virtual screening of compound libraries against ATP1B3 binding sites

    • Fragment-based drug discovery approaches

    • Rational design of peptide-based inhibitors or activators

The C-terminal immunoglobulin-like domain of ATP1B3 is of particular interest due to its potential role in both cell adhesion and immune regulation, making it a promising target for therapeutic development in viral infections .

What are the emerging applications of ATP1B3 in avian disease models?

ATP1B3 shows promising applications in avian disease models through several emerging research directions:

  • Viral infection therapeutic target: ATP1B3's ability to repress viral replication by promoting type-I interferons positions it as a potential therapeutic target in EV71 infection and potentially other viral diseases . Research approaches include:

    • Development of small molecules that enhance ATP1B3 activity

    • Gene therapy approaches to increase ATP1B3 expression

    • Peptide mimetics targeting ATP1B3-mediated pathways

  • Biomarker development: Changes in ATP1B3 expression during disease progression could serve as biomarkers for:

    • Early detection of viral infections

    • Monitoring treatment efficacy

    • Predicting disease outcomes

  • Infectious Bronchitis Virus (IBV) research: Studies have identified ATP1B3 as interacting with IBV Nsp2 protein, suggesting mechanisms through which IBV may manipulate host cell functions . This finding opens avenues for:

    • Understanding IBV pathogenesis

    • Developing targeted antiviral strategies

    • Identifying host factors essential for viral replication

  • Pain modulation applications: Research indicates that mutations within ATP1B3 may connect with differences in pain behavior, specifically in formalin pain models . This suggests potential for:

    • Pain management approaches in avian veterinary medicine

    • Comparative studies between avian and mammalian pain mechanisms

    • Development of novel analgesic compounds

  • Cell-cell adhesion research: ATP1B3's involvement in cell-cell adhesion, mediated by its immunoglobulin-like domain, suggests applications in:

    • Tissue engineering approaches

    • Regenerative medicine in avian systems

    • Understanding tissue architecture in health and disease

The diverse functions of ATP1B3 in viral defense, immune modulation, and cellular adhesion make it a versatile target for therapeutic development across multiple avian disease models.

What are the critical quality control measures for recombinant ATP1B3 production?

Ensuring high-quality recombinant ATP1B3 production requires rigorous quality control measures:

  • Sequence verification: Following cloning, comprehensive sequence verification is essential to confirm:

    • Complete coding sequence integrity

    • Correct reading frame with fusion tags

    • Absence of unintended mutations

  • Expression validation: Multiple complementary methods should confirm expression:

    • Western blotting with specific antibodies (anti-ATP1B3, anti-tag)

    • Mass spectrometry for protein identification

    • Functional assays specific to ATP1B3 activity

  • Purity assessment: Recombinant ATP1B3 preparation quality should be evaluated by:

    • SDS-PAGE with Coomassie or silver staining (>90% purity recommended)

    • Size exclusion chromatography to detect aggregation

    • Endotoxin testing for preparations intended for in vivo use

  • Functional verification: Activity assays specific to ATP1B3 function should include:

    • Association with alpha subunits

    • Membrane localization assessment

    • Na+/K+-ATPase activity measurement when in complex

  • Stability monitoring: The stability of prepared ATP1B3 should be assessed through:

    • Accelerated stability studies at different temperatures

    • Freeze-thaw cycle tolerance

    • Long-term storage condition optimization

When working with chicken ATP1B3, particular attention should be paid to the C-terminal immunoglobulin-like domain integrity, as this region is critical for protein-protein interactions and potential cell adhesion functions .

How can researchers optimize experimental design for ATP1B3 knockout/knockdown studies?

Optimizing experimental design for ATP1B3 knockout/knockdown studies requires careful consideration of several factors:

  • Knockdown approach selection:

    • siRNA: Effective for temporary ATP1B3 knockdown (50-70% reduction typically achieved)

    • shRNA: Suitable for stable knockdown models

    • CRISPR-Cas9: Preferred for complete knockout studies

  • siRNA design guidelines for ATP1B3:

    • Target sequences should be 19-21 nucleotides long

    • Avoid sequences with >16-17 contiguous base pairs of homology to other genes

    • Design multiple siRNAs targeting different regions of ATP1B3 transcript

    • Include appropriate negative controls (non-targeting siRNA)

  • Transfection optimization:

    • For CEK cells, TransIntro EL Transfection Reagent has proven effective

    • Optimal cell confluence at transfection: 50%

    • Recommended post-transfection analysis timepoints: 24, 36, and 48 hours

  • Knockdown validation:

    • qRT-PCR using validated primers (see section 3.1)

    • Western blotting with specific antibodies

    • Functional assays to confirm physiological impact

  • Rescue experiments:

    • Design rescue constructs with silent mutations in the siRNA target sequence

    • Co-transfect with siRNA to verify phenotype specificity

    • Include appropriate controls (empty vector)

  • Data analysis recommendations:

    • Use the 2^(-ΔΔCT) method for qRT-PCR data analysis

    • Standardize transcript levels against β-actin as internal reference

    • Perform statistical analysis using appropriate software (e.g., GraphPad Prism)

    • Present data as mean ± standard deviation from at least three independent experiments

When studying viral interactions with ATP1B3, researchers should consider optimal timing of infection following knockdown, as demonstrated in studies using CEK cells infected with IBV following ATP1B3 manipulation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.