Recombinant Chicken Solute carrier family 25 member 46 (SLC25A46)

Shipped with Ice Packs
In Stock

Description

Functional Roles Across Species

SLC25A46’s functions are conserved in vertebrates, as demonstrated by:

FunctionHumanBovineMurineInferred Chicken Role
Mitochondrial DynamicsPromotes fission Regulates fusion/fission balance Loss causes hyperfusion Likely modulates fission
Lipid TransportER-to-mitochondria transfer Not explicitly studiedAffects phospholipid composition Probable lipid shuttle
NeurodegenerationAxonal neuropathy, optic atrophy Sensorimotor polyneuropathy Premature death, neuropathy Potential role in neural health
MICOS Complex InteractionStabilizes cristae Mitochondrial aggregation Cristae disruption Possible cristae maintenance

Pathogenic Mutations and Implications

Missense mutations in SLC25A46 disrupt:

  • Mitochondrial architecture: Abnormal cristae, fragmented/aggregated mitochondria .

  • Protein stability: Mutations in transporter motifs (e.g., p.R257Q, p.P333L) reduce interactions with MIC60/MFN2 .

While no chicken-specific mutations are reported, pathogenic variants in other species cluster in:

  1. Transmembrane helices (e.g., bovine p.R/C substitution in helix 1) .

  2. Signature motifs (e.g., human p.E335D in the third repeat) .

Research Tools and Applications

  • Antibodies: Rabbit polyclonal antibodies against AA 1–102 (e.g., ABIN7170202) show cross-reactivity with chicken SLC25A46, validated for ELISA .

  • Therapeutic Models: AAV-mediated gene delivery rescues mitochondrial defects in Slc25a46−/− mice , suggesting potential applications in avian neurodegenerative studies.

Knowledge Gaps and Future Directions

  1. Chicken-Specific Studies: No direct biochemical or functional data on recombinant chicken SLC25A46 exist in the provided sources.

  2. Evolutionary Divergence: The extended N-terminus in chickens remains uncharacterized compared to mammals .

  3. Agricultural Relevance: Roles in avian mitochondrial health or disease resistance are unexplored.

Product Specs

Form
Lyophilized powder
Note: While we strive to ship the format currently in stock, we are happy to accommodate any specific format requirements. Please indicate your preference in the order notes, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery timeframes, please contact your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. To ensure long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can serve as a reference.
Shelf Life
The shelf life of our proteins is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is recommended. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type preference, please let us know and we will prioritize its development.
Synonyms
SLC25A46; RCJMB04_26i24; Solute carrier family 25 member 46
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-408
Protein Length
full length protein
Species
Gallus gallus (Chicken)
Target Names
SLC25A46
Target Protein Sequence
MHPRRPEGFDGLGYRGGGREEPCPGVRPFGGGAEMGHWVTTPPDIPGSRNLHWGEKTPPY GAGTPLGAAGLNEEPGLGAGGPGAEQLNRFAGFGIGLASLFTENVLAHPCIVLRRQCQVN YHARNYHLTPFTIVNIMYSINKTQGPRALWKGMGSTFIVQGITLGTEGIISEFTPLPREL SHKWNLKQIGGHLLLKGLTHVIAMPFYSASLIETVQSEIIRDNPGILDCVKEGIGRVVGM GVPHSKRLLPLMVLIFPTALHGVLHYVISSIVQKLVLLFLKRENSHSLPTESSTSVQSML DAYFPELIASFAASLCADVMLYPLETVLHRLHIQGTRTIIDNTDLGYEVLPINTQYEGMR DCINTIKREEGMLGFYKGFGAVVVQYTLHVAVLQLTKIIYSTLLQNVS
Uniprot No.

Target Background

Function
Recombinant Chicken Solute carrier family 25 member 46 (SLC25A46) may play a role in mitochondrial dynamics by controlling mitochondrial membrane fission.
Database Links
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion outer membrane; Multi-pass membrane protein.

Q&A

What is the structural organization of SLC25A46 and how does it relate to its function?

SLC25A46 belongs to the mitochondrial carrier family, featuring three tandemly repeated homologous domains of approximately 100 amino acids each. Each domain contains two transmembrane alpha-helices that form a funnel-shaped cavity allowing substrate binding and transport from the intermembrane space to the matrix through conformational transitions . The protein is primarily localized in mitochondria, as confirmed by its presence in mitochondrial-enriched protein extracts across various tissue types . The structural features of SLC25A46 suggest its involvement in transport processes across mitochondrial membranes, though its specific substrates remain incompletely characterized. Understanding these structural elements is essential for interpreting how mutations might disrupt protein function.

How does SLC25A46 sequence conservation across species inform our understanding of its functional domains?

SLC25A46 demonstrates significant evolutionary conservation, particularly in key functional regions. Analysis of amino acid sequences across species reveals highly conserved residues in transmembrane domains, suggesting their critical importance for protein function . For instance, the arginine residue in the first transmembrane helix that is mutated in the "Turning calves syndrome" is highly conserved throughout evolution in SLC25A46 proteins . Interestingly, when compared to other mitochondrial carriers, this position is often occupied by threonine in many other family members, indicating that this residue likely contributes to SLC25A46's specific biological functions rather than general carrier properties .

This conservation pattern provides valuable insights for researchers investigating structure-function relationships. Residues conserved across species but not across the wider mitochondrial carrier family likely represent SLC25A46-specific functional elements. By contrast, residues conserved across the entire carrier family may be involved in fundamental transport mechanisms shared by multiple carriers.

What cellular pathways and processes are affected by SLC25A46 dysfunction?

SLC25A46 dysfunction impacts multiple cellular pathways, with effects extending beyond the primary role in mitochondrial dynamics:

  • Mitochondrial Dynamics: The most direct impact is on the balance between mitochondrial fusion and fission. Knockout models demonstrate fusion/fission imbalance resulting in numerous round aggregated mitochondria in various tissues .

  • Energy Metabolism: Disruption of normal mitochondrial architecture affects oxidative phosphorylation and energy production, likely contributing to the observed weight loss and premature death in mouse models .

  • Neuronal Function: SLC25A46 dysfunction particularly affects nervous system tissues, causing sensorimotor polyneuropathy in cattle and ataxic gait and epilepsy in mice .

  • Gastrointestinal Function: Abnormal mitochondria in the enteric nervous system (Auerbach plexus) may contribute to intestinal dysmotility and subsequent weight loss .

  • Cellular Quality Control: Altered mitochondrial dynamics likely disrupt mitophagy and quality control processes that depend on proper fusion/fission balance.

Understanding these diverse pathway effects is crucial for interpreting experimental results and developing therapeutic approaches for SLC25A46-related disorders.

What are the recommended protocols for handling and storing recombinant SLC25A46 protein?

Recombinant SLC25A46 requires specific handling protocols to maintain stability and functionality. The protein should be stored at -20°C for standard storage, and at -20°C or -80°C for extended preservation . Working with this protein requires careful attention to temperature conditions, as repeated freeze-thaw cycles can significantly compromise protein integrity. It is therefore recommended to prepare small working aliquots that can be stored at 4°C for up to one week, minimizing exposure to freeze-thaw stress .

The protein is typically supplied in liquid form containing glycerol, which serves as a cryoprotectant . This formulation helps maintain protein stability during necessary freezing and thawing processes. When designing experiments, researchers should account for the presence of glycerol in the buffer, as it may affect certain assays or applications. Additionally, when reconstituting lyophilized preparations or diluting stock solutions, use buffers that maintain the protein's native conformation, typically at physiological pH.

What detection methods are most effective for analyzing SLC25A46 expression in different experimental contexts?

Several complementary approaches have proven effective for detecting SLC25A46 expression:

MethodApplicationRecommended ConditionsAdvantages
Western BlotProtein expression analysisDilution: 1:500-1:3000Quantitative assessment of expression levels
Tested in: Jurkat cells, mouse/rat brain tissuesDetection of post-translational modifications
PCR-LARGenotyping and mutation detectionPCR followed by Ligation Assay ReactionHigh specificity for SNP detection
RT-PCRmRNA expression analysisGene-specific primersAssessment of transcriptional regulation

For optimal results when analyzing SLC25A46 protein expression, mitochondrial-enriched protein extracts significantly improve detection sensitivity compared to total cell lysates . This approach is particularly important when studying tissues with relatively low SLC25A46 expression levels or when investigating subtle changes in expression due to experimental manipulations.

When designing primers for PCR-based detection, targeting conserved regions while avoiding polymorphic sites improves reliability across samples. The PCR-LAR method has been successfully employed for detecting the SNP associated with the "Turning calves syndrome" and can be adapted for other mutation analyses .

How can researchers generate effective knockout models to study SLC25A46 function?

Creating knockout models for SLC25A46 requires careful consideration of targeting strategy and validation methods:

  • Targeting Strategies:

    • TALEN Approach: Target exon 3 (homologous to the mutation site in bovine models) through microinjection of TALEN mRNA into embryos .

    • CRISPR/Cas9 Alternative: While not described in the available literature for SLC25A46, this approach offers precise genome editing potential.

    • Consider targeting approaches that produce complete protein loss rather than truncated proteins that might retain partial function.

  • Validation Protocol:

    • Genetic Confirmation: Sequence analysis to verify the intended genetic modification.

    • Protein Expression: Western blot analysis on both total protein and mitochondrial-enriched fractions to confirm absence of the protein .

    • mRNA Analysis: Quantitative RT-PCR to assess transcript levels and potential nonsense-mediated decay .

    • Phenotypic Assessment: Evaluate for known SLC25A46-related phenotypes (ataxia, weight loss).

  • Control Considerations:

    • Include heterozygous animals as intermediates between wild-type and knockout.

    • Consider creating "rescue" lines by reintroducing wild-type SLC25A46 to confirm phenotype specificity.

Previous successful approaches include a 75 bp deletion inducing aberrant splicing (resulting in a truncated 159 amino acid protein) and a 15 bp insertion/3 bp deletion causing amino acid substitutions in the first transmembrane domain . Both approaches resulted in undetectable SLC25A46 protein by western blot analysis, creating effective functional knockouts.

How can researchers investigate the paradoxical effects of different SLC25A46 mutations on mitochondrial morphology?

The contradictory effects of different SLC25A46 mutations on mitochondrial morphology present a fascinating research puzzle that requires systematic investigation:

  • Comparative Mutation Analysis:

    • Generate cell lines with different SLC25A46 mutations in the same genetic background.

    • Include: missense mutations in different domains, truncating mutations, and complete knockouts.

    • Quantitatively assess mitochondrial morphology parameters (fragmentation, elongation, branching) across all models.

  • Structure-Function Mapping:

    • Create chimeric proteins with domains from related mitochondrial carriers to identify regions responsible for specific functions.

    • Perform systematic alanine scanning mutagenesis of conserved residues.

    • Correlate structural alterations with changes in mitochondrial morphology.

  • Interaction Partner Investigation:

    • Identify proteins that interact with SLC25A46 using proximity labeling approaches (BioID, APEX).

    • Determine if different mutations affect distinct protein interactions.

    • Assess how mutations affect SLC25A46 localization at mitochondrial contact sites.

  • Temporal Analysis:

    • Conduct time-course studies to determine if seemingly contradictory phenotypes (increased branching vs. fragmentation) might represent different stages of the same pathological process.

    • Use live-cell imaging with fluorescently tagged mitochondria to track dynamic changes over time.

This systematic approach should help resolve whether SLC25A46 has multiple distinct functions in mitochondrial dynamics or whether the observed phenotypic differences reflect secondary adaptations to primary dysfunction .

What methodological approaches best reveal the tissue-specific impacts of SLC25A46 dysfunction?

Investigating tissue-specific effects of SLC25A46 dysfunction requires a multi-faceted approach:

  • Conditional Knockout Systems:

    • Utilize Cre-loxP technology to generate tissue-specific SLC25A46 knockouts.

    • Target tissues with different metabolic demands (neurons, cardiac/skeletal muscle, liver).

    • Employ inducible systems to control the timing of gene deletion, allowing differentiation between developmental and maintenance roles.

  • Comprehensive Tissue Analysis Pipeline:

    • Mitochondrial Morphology: Electron microscopy to quantify ultrastructural changes across tissues.

    • Functional Assessment: Tissue-specific respiratory chain function and ATP production measurements.

    • Molecular Profiling: Targeted proteomics of mitochondrial proteins in different tissues.

  • Organotypic Culture Systems:

    • Develop ex vivo culture systems that maintain tissue architecture.

    • Apply pharmacological modulators of mitochondrial dynamics to assess tissue-specific responses.

    • Use live imaging to monitor dynamic changes in mitochondrial morphology.

  • Cross-Species Comparative Analysis:

    • Compare tissue-specific manifestations across mouse models and cattle with "Turning calves syndrome" .

    • Identify conserved versus species-specific tissue vulnerabilities.

This methodological framework enables researchers to determine whether certain tissues are inherently more vulnerable to SLC25A46 dysfunction, or whether the observed spectrum of clinical manifestations reflects tissue-specific compensatory mechanisms or metabolic demands .

How might researchers investigate the molecular mechanisms linking SLC25A46 to broader mitochondrial metabolism?

The connection between SLC25A46 dysfunction and broader metabolic disturbances requires sophisticated experimental approaches:

  • Metabolic Flux Analysis:

    • Apply stable isotope-labeled substrates (13C-glucose, 13C-fatty acids) to track metabolic pathway utilization.

    • Compare flux distributions between wild-type and SLC25A46-deficient systems.

    • Identify metabolic bottlenecks and compensatory pathway activation.

  • Mitochondrial Transport Assays:

    • Develop reconstituted liposome systems with purified SLC25A46.

    • Screen candidate substrates using radioactive or fluorescently labeled compounds.

    • Measure transport kinetics to identify physiological substrates.

  • Interactome Mapping:

    • Perform quantitative proteomic analysis of SLC25A46 binding partners.

    • Focus on interactions with metabolic enzymes and other transporters.

    • Validate key interactions through co-immunoprecipitation and functional studies.

  • Mitochondrial Membrane Potential and Calcium Dynamics:

    • Use fluorescent probes to measure membrane potential in intact tissues from SLC25A46 models.

    • Assess calcium handling capacity, as disrupted calcium homeostasis can affect numerous metabolic pathways.

    • Correlate changes in membrane potential with metabolic disturbances.

  • Integrative Multi-Omics:

    • Combine transcriptomics, proteomics, and metabolomics data from affected tissues.

    • Apply network analysis to identify regulatory hubs connecting SLC25A46 dysfunction to broader metabolic effects.

This comprehensive approach would help elucidate how a protein primarily involved in mitochondrial dynamics can lead to the profound metabolic disturbances observed in knockout models, including weight loss and premature death .

What quantitative parameters should be measured when assessing mitochondrial morphology in SLC25A46 research?

Rigorous assessment of mitochondrial morphology requires standardized quantitative parameters:

ParameterDescriptionRelevance to SLC25A46Measurement Method
Aspect RatioLength/width ratio of individual mitochondriaIndicates elongation/fragmentationFluorescence microscopy with image analysis software
Form FactorPerimeter²/4π×area (measure of branching)Reveals network complexityConfocal microscopy with 3D reconstruction
Mitochondrial NumberCount of discrete mitochondria per cellIncreased in fragmentationHigh-resolution microscopy with automated particle analysis
Average SizeMean area of individual mitochondriaDecreased in fragmentationThreshold-based segmentation and measurement
Cristae DensityNumber of cristae per unit mitochondrial areaIndicator of functional capacityElectron microscopy with stereological analysis
Mitochondrial DistributionSpatial arrangement relative to cellular structuresReveals transport/positioning defectsDistance mapping from nucleus or other organelles

For SLC25A46 research specifically, these parameters should be analyzed across multiple tissues, as previous studies have shown tissue-specific variations in mitochondrial morphological responses to SLC25A46 dysfunction . Statistical analysis should include frequency distributions of these parameters rather than simple means, as mitochondrial populations often show heterogeneity that may be biologically significant.

When interpreting results, researchers should be aware that primary effects on mitochondrial morphology can trigger secondary compensatory responses. Time-course studies are therefore valuable for distinguishing immediate consequences of SLC25A46 dysfunction from adaptive responses.

How should researchers analyze phenotypic variations across different SLC25A46 mutation models?

Systematic analysis of phenotypic variations across SLC25A46 mutation models requires a structured comparative framework:

  • Standardized Phenotypic Assessment:

    • Develop a comprehensive phenotyping protocol covering neurological, metabolic, and developmental parameters.

    • Include quantitative metrics (weight progression, survival curves, behavioral tests) and qualitative observations.

    • Apply consistent methodologies across all models to enable direct comparisons.

  • Mutation Classification Strategy:

    • Categorize mutations by type: missense, truncating, deletion, regulatory region.

    • Map mutations to specific protein domains and structural features.

    • Consider evolutionary conservation at mutation sites as a predictor of functional impact.

  • Genotype-Phenotype Correlation Analysis:

    • Create correlation matrices linking specific mutation characteristics to phenotypic outcomes.

    • Identify patterns suggesting domain-specific functions (e.g., mutations in transmembrane domains may affect different functions than carrier domain mutations).

    • Apply principal component analysis to identify phenotypic clusters that might represent distinct pathophysiological mechanisms.

  • Comparative Cross-Species Integration:

    • Align phenotypic data from mouse models, cattle, and human cases.

    • Normalize for species-specific developmental timelines and physiological parameters.

    • Identify conserved phenotypic manifestations versus species-specific responses.

This systematic approach will help researchers move beyond simple descriptions of individual models to develop predictive frameworks for how specific mutations might affect protein function and resulting phenotypes .

What statistical approaches are appropriate for analyzing mitochondrial functional data in SLC25A46 studies?

Mitochondrial functional data in SLC25A46 studies presents unique statistical challenges requiring specialized approaches:

  • Dealing with Biological Variability:

    • Apply mixed-effects models to account for multiple measurements from the same animal/cell line.

    • Use hierarchical clustering to identify subpopulations of mitochondria with distinct functional profiles.

    • Consider non-parametric methods when data doesn't meet normality assumptions, as is common with mitochondrial measurements.

  • Multidimensional Data Analysis:

    • Apply principal component analysis or factor analysis to reduce dimensionality of complex mitochondrial function datasets.

    • Develop composite scores that integrate multiple related parameters (e.g., membrane potential, respiration rate, ROS production).

    • Use MANOVA when analyzing multiple related dependent variables simultaneously.

  • Time-Series Data Considerations:

    • Apply repeated measures ANOVA for longitudinal studies of mitochondrial function.

    • Consider autocorrelation structures when analyzing continuous monitoring data.

    • Use change-point analysis to identify critical thresholds in progressive dysfunction.

  • Integration with Morphological Data:

    • Apply canonical correlation analysis to relate morphological parameters to functional measurements.

    • Develop regression models that predict functional outcomes from morphological features.

    • Use mediation analysis to determine whether morphological changes directly cause functional deficits or represent parallel processes.

  • Sample Size Considerations:

    • Conduct power analyses specifically calibrated to mitochondrial data variability.

    • Consider increasing biological replicates rather than technical replicates to capture biologically meaningful variation.

    • Report effect sizes alongside p-values to communicate biological significance.

These statistical approaches help researchers extract meaningful biological insights from complex mitochondrial functional data, moving beyond simple group comparisons to understand the mechanistic relationships between SLC25A46 dysfunction and mitochondrial performance .

How can findings from SLC25A46 animal models be effectively translated to human mitochondrial disease research?

Translating findings from SLC25A46 animal models to human disease research requires careful consideration of several factors:

  • Comparative Mutation Analysis:

    • Create a comprehensive database mapping mutations across species (cattle, mice, humans).

    • Analyze equivalent mutations in different model systems to identify conserved mechanisms.

    • Develop in silico prediction tools for estimating mutation impact based on cross-species data.

  • Biomarker Development Strategy:

    • Identify consistent metabolic signatures across models that could serve as diagnostic or progression biomarkers.

    • Validate candidate biomarkers in patient samples when available.

    • Focus on accessible biomarkers (blood, urine, imaging) that could be practically implemented in clinical settings.

  • Therapeutic Target Identification:

    • Determine whether interventions targeting mitochondrial dynamics pathways show consistent effects across models.

    • Establish whether secondary metabolic pathways disrupted by SLC25A46 dysfunction represent viable intervention points.

    • Prioritize targets with demonstrated efficacy across multiple species.

  • Cross-Species Experimental Validation:

    • Test promising therapeutic approaches in multiple models before clinical translation.

    • Develop humanized mouse models expressing human SLC25A46 variants to better model human disease.

    • Establish consistent outcome measures that can bridge animal studies and potential clinical trials.

The mouse and cattle models have already provided valuable insights into SLC25A46 function, revealing that its effects extend beyond the nervous system to impact general metabolism . These broader systemic effects should be considered when developing monitoring and treatment strategies for human patients with SLC25A46 mutations.

What experimental approaches can determine the molecular basis for tissue-specific vulnerabilities to SLC25A46 dysfunction?

Understanding why certain tissues are particularly vulnerable to SLC25A46 dysfunction requires specialized experimental approaches:

  • Tissue-Specific Expression Profiling:

    • Conduct comprehensive analysis of SLC25A46 expression levels across tissues using quantitative PCR and protein analysis.

    • Map expression patterns throughout development to identify critical periods.

    • Correlate expression levels with phenotypic severity across tissues in knockout models.

  • Interactome Comparison:

    • Perform tissue-specific interactome analysis to identify differential protein interactions.

    • Use BioID or APEX proximity labeling in targeted tissues to capture context-specific interactions.

    • Determine if vulnerable tissues share common SLC25A46 interaction partners that might explain similar pathology.

  • Energy Demand Analysis:

    • Measure baseline metabolic requirements across tissues (oxygen consumption, ATP production).

    • Assess compensatory capacity when mitochondrial function is compromised.

    • Determine if tissues with high energy demands and limited compensatory mechanisms show increased vulnerability.

  • Mitochondrial Network Properties:

    • Compare baseline mitochondrial dynamics (fusion/fission rates) across tissues.

    • Assess mitochondrial quality control mechanisms and their efficiency in different cell types.

    • Determine if tissues with specific network properties are more susceptible to SLC25A46 dysfunction.

  • Experimental Manipulation:

    • Develop tissue-specific SLC25A46 rescue approaches in knockout backgrounds.

    • Modulate energy demands in specific tissues to determine if vulnerability is linked to metabolic stress.

    • Apply mitochondrial dynamics modulators to determine if enhancing fusion or fission can rescue tissue-specific phenotypes.

These approaches should help explain the particular vulnerability of nervous system tissues to SLC25A46 dysfunction while also accounting for the broader metabolic impacts observed in mouse models .

How can researchers design studies to investigate potential therapeutic approaches for SLC25A46-related disorders?

Designing studies to investigate therapeutic approaches for SLC25A46-related disorders requires a strategic framework:

  • Intervention Target Selection:

    • Direct Approaches: Gene therapy to restore functional SLC25A46 or RNA-based therapeutics to address splicing defects.

    • Indirect Approaches: Compounds that modulate mitochondrial dynamics to compensate for SLC25A46 dysfunction.

    • Metabolic Support: Interventions targeting downstream metabolic disturbances rather than the primary genetic defect.

  • Model System Selection Criteria:

    • Match the model to the specific mutation being targeted (missense vs. truncating).

    • Consider models with intermediate phenotypic severity that allow sufficient window for therapeutic effect.

    • Select appropriate controls, including heterozygous animals and treatment-naive affected animals.

  • Outcome Measure Framework:

    • Primary Endpoints:

      • Survival extension in severe models

      • Functional improvements in neurological phenotypes

      • Restoration of mitochondrial morphology

    • Secondary Endpoints:

      • Metabolic parameters (weight maintenance, energy expenditure)

      • Biochemical markers of mitochondrial function

      • Quality of life measures in animal models (activity, feeding behavior)

  • Intervention Timing Considerations:

    • Pre-symptomatic treatment to prevent disease onset

    • Early intervention to halt disease progression

    • Late intervention to determine reversibility of established phenotypes

  • Combination Approach Strategy:

    • Test synergistic effects of combined interventions (e.g., gene therapy plus metabolic support)

    • Investigate tissue-targeted approaches for organs most severely affected

    • Consider staged therapeutic approaches with different mechanisms at different disease stages

This framework provides a systematic approach to therapeutic development for SLC25A46-related disorders, addressing both the primary genetic defect and its downstream consequences. The mouse models described in the literature offer valuable platforms for testing these interventions before potential clinical translation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.