Recombinant Chicken Spastin (SPAST)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Chicken Spastin (SPAST)

Spastin is a protein that is encoded by the SPAST gene, and it belongs to the AAA (ATPase Associated with various cellular Activities) protein family . These proteins are involved in various cellular functions, including the regulation of cell components and proteins . Specifically, spastin functions as a microtubule-severing enzyme, regulating microtubule abundance, mobility, and plus-end distribution . Microtubules are essential components of the cell's cytoskeleton, involved in intracellular transport and cell division .

Recombinant spastin is produced using genetic engineering techniques, where the gene encoding spastin is inserted into a host organism (e.g., E. coli) to produce the protein in large quantities . "Recombinant Chicken Spastin (SPAST)" refers to the spastin protein produced in this manner, specifically derived from the chicken SPAST gene.

Function and Significance

Spastin plays a crucial role in microtubule dynamics, contributing to the biogenesis and maintenance of complex microtubule arrays found in axons, spindles, and cilia . It participates in the abscission step of cytokinesis and the reassembly of the nuclear envelope during anaphase . Spastin is recruited to the midbody, likely by IST1, where it participates in membrane fission during abscission along with the ESCRT-III complex . It is also recruited to the nuclear membrane by IST1 and mediates microtubule severing, which promotes nuclear envelope sealing and mitotic spindle disassembly during late anaphase .

Association with Hereditary Spastic Paraplegia (HSP)

Mutations in the SPAST gene are the most frequent cause of autosomal dominant spastic paraplegia type 4 (SPG4) . This neurodegenerative disorder is characterized by progressive lower limb spasticity and weakness . Approximately 40% of autosomal dominant hereditary spastic paraplegias are caused by mutations in the SPAST gene . These mutations impair spastin's ability to regulate microtubules, leading to the disruption of organelle transport, especially in nerve cells, contributing to the symptoms of HSP .

Spastin and Atlastin Interaction

Spastin interacts with atlastin, another protein associated with hereditary spastic paraplegia . The N-terminal domain of spastin binds directly to the C-terminal cytoplasmic domain of atlastin . This interaction suggests that multiple HSP-related genes may define a cellular biological pathway critical for axon maintenance . Studies have shown that the C-tail of atlastin is both necessary and sufficient for spastin recruitment .

Research and Applications

  • Expression and Purification: Recombinant spastin can be expressed in E. coli and purified for functional studies . Optimizing the expression conditions facilitates the study of spastin's structure-function relationship.

  • ATPase Activity: Spastin belongs to the AAA ATPase family, and its conserved amino acids in the AAA motifs contribute to ATP binding and hydrolysis .

  • Microtubule Severing: Spastin's microtubule-severing activity is independent of whether or not MAPs (microtubule-associated proteins) remain attached to the microtubules .

  • ELISA Kit: An ELISA (Enzyme-Linked Immunosorbent Assay) kit is available for the detection of Chicken Spastin (SPAST) in biological samples, indicating its utility in quantifying spastin levels . The ELISA kit is designed to be sensitive and specific for Chicken SPAST, with no significant cross-reactivity or interference between Chicken SPAST and its analogues .

Experimental data

ExperimentDescriptionFindings
Yeast Two-Hybrid AnalysisExamined the interaction between spastin and atlastin, two proteins associated with Hereditary Spastic Paraplegia (HSP).Showed that the C-tail of atlastin binds spastin in an ATP-independent manner, demonstrating direct interaction .
Immunofluorescence MicroscopyUsed to detect endogenous spastin.The amount of endogenous spastin staining is proportional to the amount of atlastin C-tail Golgi expressed, suggesting that the C-tail of atlastin is necessary and sufficient for spastin recruitment. There is a good correlation between levels of atlastin and spastin on a cell-by-cell basis .
Quantitative Western BlottingExamined spastin levels after transfecting cells with YFP, atlastin-YFP, or atlastin C-tail Golgi.Overexpression of atlastin-YFP resulted in an approximately 3-fold increase in the spastin signal, whereas overexpression of atlastin C-tail-Golgi resulted in a 7.8-fold increase in spastin. This indicates that atlastin overexpression leads to increased spastin levels .
ATPase Activity AssayMeasured the ATPase activity of recombinant Spastin-C389 and its mutant (Spastin-C389-E439A) purified from E. coli.The purified Spastin-C389, containing the AAA domain, was expected to have ATPase activity. The Spastin-C389-E439A mutant, which contains a mutation in the AAA domain, was used as a control to deactivate the enzyme .
Microtubule Severing AssayAssessed the impact of atlastin on spastin-mediated microtubule severing in vitro.While the assay likely has a large margin of error, the data suggests that atlastin might modulate spastin activity, though no significant atlastin-induced alterations in the extent or apparent rate of microtubule shortening were detected .
Chicken Spastin(SPAST) ELISA KitQuantitative measurement of Chicken Spastin (SPAST) levels.The Chicken Spastin(SPAST) ELISA kit is sensitive and specific for detection of Chicken SPAST. No significant cross-reactivity or interference between Chicken SPAST and analogues was observed. Standard deviation is less than 8% for standards repeated 20 times on the same plate. It is less than 10% when the same sample is measured 20 times by different operators .
Expression of Recombinant Mouse Spastin in E. coliStudy of recombinant mouse spastin expression.Systematically optimized the expression condition of a truncated version of mouse spastin in E. coli. The recombinant protein and a mutant were further purified for ATPase activity assay .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
SPAST; SPG4; RCJMB04_12e12; Spastin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-613
Protein Length
full length protein
Species
Gallus gallus (Chicken)
Target Names
SPAST
Target Protein Sequence
MNSPGGRGKKKGSAGSSSAPPAAGASPSAPSGPAPPAPPAGAAAAAAASPHKRNLYYFSY PLFAAFALLRFVAFQLGLLVAWLCERLSRGALMAAKSSRAGDAPEPGGAAERVRACHKRA FECISMALRIDEDERAGQKEQAVEWYKKGIEELERGIAVLVVGQGDQCERARRLQSKMMT NLAMAKDRLQLLEKLQADLQISKPQMEVYNDSTNLACRNGHLQSESGAVPKKKDPLTHTS NSLPRSKTVAKTGSTGLSGHHRTPSYSGISTASVSRPAANPATSTHKAAPKNSRTNKPST PTPAARKKKDTKVFRNVDSNLANLILNEIVDSGPAVKFDDIAGQELAKQALQEIVILPSL RPELFTGLRAPARGLLLFGPPGNGKTMLAKAVAAESNATFFNISAASLTSKYVGEGEKLV RALFAVARELQPSIIFIDEVDSLLCERREGEHDASRRLKTEFLIEFDGVQSSGEDRILVM GATNRPQELDDAVLRRFTKRVYVSLPNEETRLILLKNLLSKQGSPLTQKELAQLARMTDG YSGSDLTALVKDAALGPIRELKPEQVKNMSASEMRNIKLSDFTESLKKIKRSLSPQTLEA YIRWNKDFGDTTV
Uniprot No.

Target Background

Function
Recombinant Chicken Spastin (SPAST) is an ATP-dependent microtubule-severing protein that specifically targets and cleaves polyglutamylated microtubules. It exhibits a preference for microtubules with short polyglutamate tails; severing activity increases with the number of glutamates per tubulin (from one to eight), but decreases beyond this threshold. This microtubule severing activity facilitates the reorganization of cellular microtubule networks and the release of microtubules from the centrosome post-nucleation. Spastin is essential for membrane trafficking between the endoplasmic reticulum (ER) and the Golgi apparatus, and for completing cytokinesis abscission. It also plays a crucial role in axon growth and branching.
Database Links

KEGG: gga:421481

UniGene: Gga.21964

Protein Families
AAA ATPase family, Spastin subfamily
Subcellular Location
Membrane; Peripheral membrane protein. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Cytoplasm, cytoskeleton. Cytoplasm, perinuclear region. Nucleus.

Q&A

What are the key functional domains of chicken SPAST and their roles?

Based on homology with human SPAST, chicken SPAST contains several key functional domains:

  • AAA ATPase domain: This domain binds and hydrolyzes ATP, providing the energy required for microtubule severing. Mutations that impair either ATP binding or hydrolysis severely compromise SPAST activity .

  • Microtubule-binding domain: This region allows SPAST to interact directly with microtubules, which is necessary for its severing function. Studies with purified components have confirmed that SPAST interacts directly with microtubules and is sufficient for severing .

  • MIT (microtubule interacting and trafficking) domain: This domain mediates interactions with the ESCRT-III complex and is involved in processes like cytokinesis and nuclear envelope reassembly during anaphase .

  • N-terminal region: Alternative translational initiation sites result in isoforms that differ in their N-terminal length, affecting nuclear export efficiency and cytoplasmic localization .

The interplay between these domains enables SPAST to participate in diverse cellular processes beyond simple microtubule severing, including abscission during cytokinesis and nuclear envelope reassembly .

Why is chicken SPAST utilized as a model for studying microtubule dynamics?

Chicken SPAST offers several advantages as a model for studying microtubule dynamics. The chicken embryo system has been a valuable research tool since the 1930s for developmental biology, embryology, and disease modeling . The well-established methodologies for chicken embryo manipulation make it particularly suitable for studying cytoskeletal proteins like SPAST in a developmentally relevant context.

Additionally, the avian genome has distinctive features compared to mammalian genomes, including high GC content, which presents unique challenges and opportunities for understanding protein function across evolutionary distance . Studying chicken SPAST can reveal conserved mechanisms of microtubule regulation while also highlighting avian-specific adaptations.

The development of transgenic technologies and gene editing tools for chickens, particularly the application of CRISPR/Cas9 systems, has further enhanced the utility of chicken models for studying proteins like SPAST . These advances allow researchers to investigate SPAST function in vivo within the context of the whole organism, complementing in vitro biochemical studies with recombinant protein.

What expression systems are optimal for producing functional recombinant chicken SPAST?

Multiple expression systems can be employed for producing recombinant chicken SPAST, each with specific advantages for different research objectives:

Expression SystemAdvantagesLimitationsBest Applications
E. coliHigh yield, rapid expression, cost-effectiveMay not support proper folding of complex proteins, limited post-translational modificationsInitial characterization, mutational studies
Insect cells (Baculovirus)Better protein folding, some post-translational modificationsMore complex than bacterial systems, moderate yieldFunctional studies requiring active enzyme
Mammalian cellsMost physiologically relevant modifications, proper foldingLower yield, expensive, time-consumingStudies of protein-protein interactions, cellular localization
Transgenic chicken systemsNative post-translational modifications, in vivo expressionComplex methodology, longer timeframeIn vivo studies, large-scale production

For functional studies requiring active SPAST, insect cell or mammalian expression systems are generally recommended. Research has shown that recombinant SPAST produced in these systems retains microtubule-severing activity when tested in biochemical assays . The choice of expression system should align with specific experimental requirements, considering factors such as protein yield, activity, and downstream applications.

What are critical factors in purifying enzymatically active chicken SPAST?

Purifying enzymatically active chicken SPAST requires careful attention to several critical factors:

  • Fusion tags: GST (glutathione S-transferase) and MBP (maltose binding protein) tags have been successfully used with spastin . These tags enhance solubility and provide convenient purification handles.

  • Buffer composition:

    • pH range: Typically 7.5-8.0 (HEPES or Tris buffer)

    • Salt concentration: 100-150 mM NaCl to maintain solubility while preserving specific interactions

    • Divalent cations: 2-5 mM MgCl₂ required for ATPase activity

    • Reducing agents: 1-5 mM DTT or β-mercaptoethanol to prevent oxidation

    • Nucleotides: ATP or non-hydrolyzable analogs help stabilize protein conformation

  • Temperature management: Maintaining low temperatures (4°C) throughout purification helps preserve activity by reducing proteolysis and denaturation.

  • Protease inhibitors: Including a cocktail of protease inhibitors prevents degradation during extraction and purification steps.

  • Chromatography strategy: A multi-step approach typically yields the best results:

    • Affinity chromatography based on fusion tag

    • Ion exchange chromatography for intermediate purification

    • Size exclusion chromatography to ensure homogeneity and remove aggregates

Studies have demonstrated that properly purified recombinant spastin maintains its ability to interact directly with microtubules and is sufficient for severing , confirming that enzymatic activity can be preserved through appropriate purification procedures.

How can researchers validate the proper folding and activity of purified chicken SPAST?

Validating proper folding and activity of purified chicken SPAST requires a multi-faceted approach:

  • Biophysical characterization:

    • Circular dichroism (CD) spectroscopy to assess secondary structure

    • Intrinsic tryptophan fluorescence to monitor tertiary structure

    • Thermal shift assays to evaluate protein stability

    • Size exclusion chromatography to confirm proper oligomeric state

  • Enzymatic activity assays:

    • ATPase activity measurement using colorimetric assays for phosphate release

    • Comparison with ATP hydrolysis-deficient mutants as negative controls

    • Kinetic analysis to determine enzyme parameters (Km, Vmax)

  • Functional microtubule severing assays:

    • Real-time imaging of fluorescently labeled microtubules incubated with SPAST

    • Quantification of microtubule length before and after SPAST addition

    • Time-course measurements to determine severing rates

    • Fixed-endpoint assays using glutaraldehyde to stop reactions at specific timepoints

  • Protein-protein interaction validation:

    • Pull-down assays with known binding partners (e.g., testing whether chicken SPAST can interact with atlastin, as shown for human SPAST)

    • Co-immunoprecipitation from relevant cellular extracts

A properly folded and active SPAST preparation should demonstrate both ATPase activity and microtubule severing capability, with the latter being directly observable through microscopy-based assays as demonstrated in previous studies .

What assays can quantitatively measure chicken SPAST microtubule-severing activity?

Several quantitative assays can be employed to measure chicken SPAST microtubule-severing activity:

  • In vitro fluorescence microscopy-based severing assay:

    • Prepare stabilized microtubules using taxol and fluorescently labeled tubulin

    • Add purified SPAST and ATP to initiate severing

    • Capture images at defined time intervals

    • Quantify average microtubule length or number at each timepoint

    • Calculate severing rate constants from exponential decay curves

    • Fix samples with glutaraldehyde at specific timepoints for endpoint analysis

  • Bulk solution turbidity assay:

    • Monitor microtubule polymer mass through turbidity measurements (absorbance at 350 nm)

    • Add SPAST and record the decrease in turbidity over time

    • Calculate severing rates from the slope of turbidity decrease

    • Compare wild-type protein with ATPase-deficient mutants as controls

  • Total internal reflection fluorescence (TIRF) microscopy:

    • Immobilize fluorescently labeled microtubules on functionalized coverslips

    • Add SPAST and ATP while imaging in real-time

    • Quantify individual severing events per unit length of microtubule

    • Determine both frequency and location preferences of severing

  • Cellular microtubule network disruption:

    • Add SPAST to permeabilized cells expressing fluorescent tubulin markers

    • Monitor changes in microtubule network integrity over time

    • Quantify network density using image analysis algorithms

These assays can be calibrated using well-characterized mutants, such as ATP-binding deficient (K388A) and ATP hydrolysis-deficient (E442Q) variants, which serve as important controls for distinguishing between specific and non-specific effects .

How does the ATP hydrolysis cycle regulate chicken SPAST severing activity?

The ATP hydrolysis cycle is central to SPAST function, with distinct states in the cycle corresponding to different functional states of the protein:

  • ATP-free state: In the absence of nucleotide, SPAST has low affinity for microtubules and remains largely inactive.

  • ATP-bound state: ATP binding induces conformational changes that promote microtubule binding. This state is mimicked by ATP hydrolysis-deficient mutants (e.g., E442Q), which can bind but not sever microtubules .

  • ATP hydrolysis transition state: This represents the catalytically active conformation that exerts mechanical force on the microtubule lattice.

  • ADP-bound state: Following hydrolysis, SPAST in the ADP-bound state has reduced affinity for microtubules, promoting release and recycling of the enzyme.

Studies have shown that mutations affecting ATP binding prevent microtubule decoration, while hydrolysis-deficient mutants decorate microtubules but cannot sever them . This distinction is particularly relevant for understanding disease-associated mutations, as some more closely resemble the ATP-binding mutant phenotype while others resemble the hydrolysis mutant .

The coupling between ATP hydrolysis and mechanical force generation appears to be highly conserved in AAA ATPases, suggesting that chicken SPAST would follow similar principles to its human counterpart. Experimental evidence indicates that ATP hydrolysis provides the energy required for SPAST to disrupt the microtubule lattice, resulting in severing at specific sites .

What protein-protein interactions are critical for chicken SPAST function?

While chicken-specific interaction data is limited, research on human SPAST reveals several protein-protein interactions likely conserved in chicken SPAST:

  • Atlastin interaction:

    • Human SPAST directly interacts with atlastin-1, another protein implicated in hereditary spastic paraplegia

    • This interaction occurs through the C-terminal tail of atlastin and is ATP-independent

    • The interaction can be demonstrated through pull-down assays with recombinant proteins

    • While atlastin binding has minimal effect on SPAST's ATPase activity, it may regulate localization or substrate targeting

  • ESCRT-III complex interactions:

    • SPAST interacts with components of the ESCRT-III complex, particularly IST1

    • This interaction recruits SPAST to specific cellular locations such as the midbody during cytokinesis

    • SPAST contributes to membrane fission during abscission alongside the ESCRT-III complex

  • Tubulin/microtubule interaction:

    • Direct binding to microtubules is essential for SPAST's severing function

    • This interaction involves recognition of specific structural features or post-translational modifications on tubulin

These interactions collectively regulate SPAST's cellular localization, activation, and substrate specificity. Researchers studying chicken SPAST should develop interaction assays including yeast two-hybrid screens, co-immunoprecipitation experiments, and direct binding assays with recombinant proteins to identify both conserved and potentially avian-specific interaction partners .

How can chicken SPAST be utilized in developmental neurobiology research?

Chicken SPAST offers several valuable applications in developmental neurobiology research:

  • Axonal development and maintenance:

    • Given SPAST's role in microtubule dynamics and its association with axonopathy in humans , chicken SPAST can be used to study axonal growth and maintenance

    • Microinjection of wild-type or mutant SPAST into developing neurons allows real-time observation of effects on axonal outgrowth

    • Comparison between effects in avian versus mammalian neurons can reveal conserved mechanisms of axonal maintenance

  • Gene editing approaches:

    • CRISPR/Cas9 technology has been successfully applied in chickens, allowing targeted modification of the endogenous SPAST gene

    • This enables creation of chicken models with specific SPAST mutations to study neurodevelopmental consequences

    • The established protocol involving primordial germ cell (PGC) editing provides a pathway to generate germline-modified chickens

  • Embryonic manipulation:

    • The accessibility of chicken embryos for manipulation makes them excellent models for studying neural development

    • Electroporation of SPAST constructs into specific regions of the developing neural tube allows spatially controlled expression

    • Time-lapse imaging of labeled neurons following SPAST manipulation can reveal dynamic effects on neuronal morphogenesis

  • Comparative studies:

    • Comparing the function of chicken SPAST with mammalian orthologs can highlight evolutionarily conserved mechanisms

    • Such studies may reveal adaptations specific to avian nervous system development and maintenance

The chicken embryo model has historical significance in developmental biology research , and combining this established system with modern molecular tools provides powerful approaches for studying SPAST's role in neurodevelopment.

What approaches can be used to study chicken SPAST in the context of microtubule-related diseases?

Several approaches can be employed to study chicken SPAST in the context of microtubule-related diseases:

  • Disease mutation modeling:

    • Introduction of mutations equivalent to human disease-associated variants into chicken SPAST

    • Comparison of biochemical properties between wild-type and mutant proteins

    • Analysis of how these mutations affect ATPase activity and microtubule severing

    • Classification of mutations based on their resemblance to either ATP-binding or ATP-hydrolysis deficient phenotypes

  • Transgenic disease models:

    • Generation of transgenic chickens expressing mutant SPAST using CRISPR/Cas9 technology and primordial germ cell manipulation

    • Creation of chicken models that express human disease variants of SPAST

    • Phenotypic analysis of these models to identify neurodevelopmental or neurodegenerative changes

  • Cell-based disease modeling:

    • Derivation of primary neuronal cultures from normal and SPAST-modified chicken embryos

    • Analysis of neuronal morphology, axonal transport, and microtubule dynamics

    • Comparison with mammalian cellular models of hereditary spastic paraplegia

  • Therapeutic screening:

    • Use of chicken SPAST-based assays to screen for compounds that might restore function to disease-associated mutants

    • Testing whether factors that modulate microtubule dynamics can compensate for SPAST dysfunction

    • Validation of candidates in progressively more complex models (biochemical → cellular → embryonic → adult)

These approaches leverage the understanding that defects in microtubule severing contribute to axonal degeneration in human disease , allowing researchers to use the chicken system to investigate conserved disease mechanisms and potential therapeutic strategies.

How can gene editing technologies be applied to study chicken SPAST function in vivo?

Modern gene editing technologies offer powerful approaches for studying chicken SPAST function in vivo:

  • CRISPR/Cas9 methodology for chicken gene editing:

    • The CRISPR/Cas9 system requires only Cas9 nuclease and sgRNA targeting specific genomic sequences

    • Multiple sgRNAs can be used simultaneously to target different sites, allowing complex editing strategies

    • This technology has been successfully applied in various chicken cell types, including primordial germ cells (PGCs)

  • Primordial germ cell (PGC) approach:

    • PGCs can be isolated, cultured in vitro, and genetically modified while maintaining germline transmission capability

    • After CRISPR editing, modified PGCs are transplanted into recipient embryos to create germline chimeric individuals (G0 generation)

    • These G0 roosters are bred to produce heterozygous mutant chickens (G1), which can be further bred to create homozygous mutants (G2)

    • This established breeding pipeline enables the creation of stable chicken lines with specific SPAST modifications

  • Specific SPAST editing strategies:

    • Knockout models: Complete elimination of SPAST expression to understand its essential functions

    • Knock-in models: Introduction of specific mutations (e.g., disease-associated variants) or tags (fluorescent proteins)

    • Domain deletion/modification: Targeted alteration of specific functional domains

    • Regulatory region modification: Alteration of expression patterns or levels

  • Phenotypic analysis approaches:

    • Developmental studies: Analysis of embryonic development and hatching rates

    • Histological examination: Assessment of neuronal morphology and potential degeneration

    • Behavioral studies: Evaluation of motor function and coordination

    • Molecular analysis: Examination of microtubule dynamics and organization in tissues

The established protocols for chicken gene editing described in recent literature provide a clear pathway for generating genetically modified chickens with altered SPAST function , enabling comprehensive in vivo studies that complement biochemical and cellular approaches.

What strategies can overcome common challenges in expressing and purifying functional chicken SPAST?

Researchers working with chicken SPAST may encounter several challenges, which can be addressed with these strategies:

  • Addressing solubility issues:

    • Use solubility-enhancing fusion tags such as MBP, GST, or SUMO tags

    • Optimize expression temperature (typically lowering to 16-18°C improves folding)

    • Include solubility enhancers in buffers (10-15% glycerol, 0.1-0.5% non-ionic detergents)

    • Consider co-expression with chaperones to assist proper folding

  • Preventing proteolytic degradation:

    • Include comprehensive protease inhibitor cocktails in all buffers

    • Minimize time between cell lysis and initial purification steps

    • Consider removing flexible, protease-susceptible regions through rational construct design

    • Maintain samples at 4°C throughout processing

  • Enhancing protein stability:

    • Include ATP or non-hydrolyzable ATP analogs to stabilize protein conformation

    • Use hydrophobic probe screening (e.g., ANS fluorescence) to identify conditions that minimize exposed hydrophobic patches

    • Implement buffer screening to identify optimal pH, salt concentration, and additives

    • Monitor protein homogeneity using dynamic light scattering or analytical size exclusion chromatography

  • Refolding from inclusion bodies:

    • If inclusion bodies form, implement step-wise refolding protocols with decreasing denaturant concentrations

    • Monitor refolding using intrinsic tryptophan fluorescence to track tertiary structure formation

    • Use size exclusion chromatography to separate properly folded protein from aggregates

    • Validate refolded protein activity using functional assays

These strategies build on established protocols for working with complex AAA ATPases and can be tailored to address specific challenges encountered with chicken SPAST.

How can mutation studies be designed to understand structure-function relationships in chicken SPAST?

Strategic mutation studies can reveal important structure-function relationships in chicken SPAST:

  • Rational mutation design based on functional domains:

    • ATP binding site mutations (e.g., Walker A motif lysine to alanine) to eliminate nucleotide binding

    • ATP hydrolysis mutations (e.g., Walker B motif glutamate to glutamine) to allow binding but prevent hydrolysis

    • Microtubule-binding interface mutations to alter substrate recognition

    • Protein-protein interaction interface mutations (e.g., in regions homologous to those that bind atlastin in human SPAST)

  • Disease-relevant mutation analysis:

    • Introduction of mutations equivalent to human disease-associated variants

    • Classification of mutations based on their functional effects (ATP binding vs. hydrolysis defects)

    • Correlation between biochemical defects and cellular phenotypes

  • Systematic mutation approaches:

    • Alanine-scanning mutagenesis of specific domains or surfaces

    • Creation of chimeric proteins between chicken and human SPAST to map species-specific functions

    • Introduction of cysteine residues for site-specific labeling and FRET studies

  • Comprehensive functional characterization:

    • ATPase activity measurements to quantify enzymatic function

    • Microtubule binding assays to assess substrate recognition

    • Microtubule severing assays to measure primary functional output

    • Protein-protein interaction studies to map binding interfaces

This multi-parameter approach allows researchers to build comprehensive structure-function maps of chicken SPAST and compare them with data from mammalian orthologs, potentially revealing both conserved mechanisms and avian-specific adaptations.

What advanced imaging techniques can visualize chicken SPAST activity in real-time?

Several advanced imaging techniques can be employed to visualize chicken SPAST activity in real-time:

  • Fluorescence microscopy approaches:

    • Real-time imaging of fluorescently labeled microtubules with added recombinant SPAST

    • Dual-color imaging using differentially labeled tubulin and SPAST to visualize enzyme-substrate interactions

    • TIRF microscopy to achieve high signal-to-noise ratio for single microtubule analysis

    • Spinning disk confocal microscopy for rapid 3D acquisition of microtubule networks

  • Super-resolution techniques:

    • Structured illumination microscopy (SIM) to achieve ~100 nm resolution

    • Stimulated emission depletion (STED) microscopy for visualization of microtubule structural details

    • Single-molecule localization microscopy (PALM/STORM) to map individual SPAST molecules on microtubules

  • Specialized probes and techniques:

    • FRET-based sensors to monitor ATP binding and hydrolysis states

    • Photoactivatable or photoconvertible fluorescent protein fusions to track SPAST dynamics

    • Fluorescence recovery after photobleaching (FRAP) to measure binding/unbinding kinetics

    • Fluorescence correlation spectroscopy (FCS) to analyze diffusion properties and oligomerization

  • Live-cell applications:

    • Expression of fluorescently tagged SPAST in cultured cells or embryonic tissues

    • Cell permeabilization approaches allowing introduction of recombinant SPAST into semi-intact cells

    • Microinjection of labeled SPAST into developing neurons or embryos

These imaging approaches build upon established techniques demonstrated in the literature, such as real-time imaging of spastin-mediated microtubule severing in permeabilized cells , while incorporating newer technologies for enhanced spatial and temporal resolution.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.