Recombinant Chicken Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial (SDHD)

Shipped with Ice Packs
In Stock

Description

Biological Function of SDHD in Avian Metabolism

The SDHD protein serves as a critical component of mitochondrial energy metabolism in chickens, functioning at the intersection of two major energy-producing pathways: the citric acid cycle (Krebs cycle) and oxidative phosphorylation .

Role in Succinate Dehydrogenase Complex

Within the SDH enzyme (Complex II of the respiratory chain), SDHD anchors the complex to the inner mitochondrial membrane. The SDH enzyme catalyzes the oxidation of succinate to fumarate in the citric acid cycle while simultaneously reducing ubiquinone to ubiquinol in the electron transport chain . This dual function makes SDH unique among respiratory complexes as it directly links these two essential energy-producing pathways.

Function in Electron Transport

During the conversion of succinate to fumarate, electrons are released and transferred through the various SDH subunits, including through SDHD, before being delivered to ubiquinone in the electron transport chain. This electron transfer is critical for generating the proton gradient needed for ATP synthesis through oxidative phosphorylation .

Oxygen Sensing and Cell Signaling

Research suggests that succinate, the substrate of SDH, functions as an oxygen sensor in cells. By controlling succinate levels, the SDH complex (including SDHD) can influence hypoxia-inducible factor (HIF) stability, which regulates cellular responses to low oxygen conditions . This oxygen-sensing mechanism appears conserved across species, including in chickens.

Role as Tumor Suppressor

The SDHD gene functions as a tumor suppressor in many species, preventing uncontrolled cell growth and division. Mutations in SDHD have been associated with various human tumors, particularly paragangliomas and pheochromocytomas . While less studied in chickens specifically, the conservation of this function across species suggests similar roles in avian biology.

Expression Systems

Recombinant chicken SDHD is typically produced in bacterial expression systems, with E. coli being the most common host organism . The protein coding sequence is cloned into expression vectors that allow for controlled protein production and often include affinity tags to facilitate purification.

Purification Methods

Commercial preparations of recombinant chicken SDHD commonly utilize His-tag affinity purification methods . The addition of a polyhistidine tag (typically at the N-terminus) allows for efficient purification using metal affinity chromatography. Following purification, the protein undergoes quality control testing to ensure proper folding and high purity.

Quality Control Measures

Standard quality control measures for recombinant chicken SDHD include:

  1. SDS-PAGE analysis to confirm protein size and purity (typically >90%)

  2. Western blot analysis to confirm identity

  3. Mass spectrometry to verify amino acid sequence

  4. Functional assays to assess biological activity where applicable

Research Applications and Significance

Recombinant chicken SDHD has multiple applications in research, spanning basic biochemistry to applied poultry science.

Mitochondrial Research

Recombinant SDHD is valuable for studying mitochondrial function and dysfunction in avian species. Research has shown that mitochondrial dysfunction is implicated in various conditions affecting chickens, including wooden breast myopathy and runting and stunting syndrome (RSS) . Studies utilizing recombinant SDHD can help elucidate the molecular mechanisms underlying these conditions.

Comparative Biochemistry

The availability of recombinant chicken SDHD enables comparative studies with SDHD proteins from other species, including humans, mice, and other livestock species. These comparisons can reveal evolutionary conservation and divergence in mitochondrial function across species .

Marek's Disease Research

Studies have implicated mitochondrial function in Marek's disease, a highly contagious T-cell lymphoid neoplasia in chickens caused by Marek's disease virus (MDV). Research has shown that succinate dehydrogenase subunits, including SDHB, SDHC, and SDHD, are associated with the pathogenesis of this disease .

Antibody Production and Immunological Studies

Recombinant chicken SDHD can be used to generate specific antibodies for immunological studies, protein localization, and diagnostic assays. These antibodies can serve as tools for studying SDHD expression and distribution in various tissues and under different physiological conditions .

Available Forms

Commercial preparations typically include:

  1. Full-length mature protein (amino acids 46-157) with N-terminal His-tag

  2. Partial protein fragments for specific applications

  3. Custom-produced variants with different tags or modifications

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format in the order notes and we will do our best to fulfill your requirement.
Lead Time
Delivery time may vary depending on the purchasing method and location. For precise delivery estimates, please consult your local distributors.
Note: Our proteins are shipped standard with blue ice packs. If you require dry ice shipping, please notify us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing should be avoided. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by factors including storage conditions, buffer components, storage temperature, and the intrinsic stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. To maintain optimal quality, avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type in mind, please inform us and we will prioritize developing the specified tag.
Synonyms
SDHD; RCJMB04_23p7; Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial; CybS; Succinate dehydrogenase complex subunit D; Succinate-ubiquinone oxidoreductase cytochrome b small subunit; Succinate-ubiquinone reductase membrane anchor subunit
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
46-157
Protein Length
Full Length of Mature Protein
Species
Gallus gallus (Chicken)
Target Names
Target Protein Sequence
SHGGAPQGHGSSKAASLHWTSERAVSALLLGLLPAAYLYPGPAVDYSLAAALTLHGHWGL GQVITDYVHGDTPIKVANTGLYVLSAITFTGLCYFNYYDVGICKAVAMLWSI
Uniprot No.

Target Background

Function
This membrane-anchoring subunit of succinate dehydrogenase (SDH) plays a vital role in complex II of the mitochondrial electron transport chain. It facilitates the transfer of electrons from succinate to ubiquinone (coenzyme Q).
Database Links
Protein Families
CybS family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the role of SDHD in the succinate dehydrogenase complex?

SDHD serves as one of the four essential subunits (SDHA, SDHB, SDHC, and SDHD) that comprise the succinate dehydrogenase complex (Complex II). Specifically, SDHD is a hydrophobic transmembrane protein that, together with SDHC, anchors the entire complex to the inner mitochondrial membrane. These transmembrane subunits form the structural foundation for the ubiquinone binding site (Qp site), which is critical for the electron transfer process from succinate to ubiquinone in the respiratory chain .

The functional SDH complex catalyzes the oxidation of succinate to fumarate while transferring electrons to coenzyme Q in the respiratory electron transfer chain. During this process, SDHD works in concert with SDHB and SDHC to facilitate the two-step reduction of ubiquinone, which involves the transient formation of a semiquinone radical and requires interaction with a heme group that is an integral part of the complex .

How conserved is the SDHD protein across species compared to other SDH subunits?

Among the subunits forming the Qp site of the SDH complex, SDHD shows remarkably low sequence conservation across species. Analyses of ascomycetes sequences reveal that SDHD displays only about 21% identity across species, similar to SDHC which shows approximately 22% identity. This stands in sharp contrast to the SDHB subunit, which exhibits much higher conservation with 57% identity across the same species .

What cellular processes require functional SDHD protein?

Functional SDHD is essential for multiple cellular processes including:

  • ATP production via oxidative phosphorylation, as SDH couples the tricarboxylic acid cycle to the electron transport chain .

  • Maintenance of cellular redox balance, as proper SDH function prevents the accumulation of reactive oxygen species (ROS) .

  • Support of cellular differentiation processes, particularly in tissues with high energy demands. Mitochondrial remodeling during cell differentiation is crucial for enhancing ATP generation capacity, and functional SDH components are necessary for this process .

  • Prevention of succinate accumulation, which, if occurs, can lead to inhibition of hypoxia-inducible factor α (HIFα) prolyl hydroxylases and subsequent pseudo-hypoxic responses that may contribute to tumorigenesis in certain tissues .

What expression systems are most effective for producing recombinant chicken SDHD protein?

For recombinant expression of chicken SDHD, researchers have successfully employed several systems with varying advantages for different experimental objectives:

  • Codon optimization is essential as avian codon usage differs significantly from bacterial systems, particularly for membrane proteins like SDHD.

  • Expression as a fusion protein with solubility tags (e.g., MBP, GST, or SUMO) helps overcome the hydrophobic nature of SDHD.

  • Culture conditions require careful optimization, typically using lower induction temperatures (16-20°C) and reduced IPTG concentrations to enhance proper folding.

Eukaryotic Expression Systems:
For functional studies requiring proper post-translational modifications and membrane integration:

  • Insect cell expression (Sf9, Sf21, or High Five cells) using baculovirus vectors can provide higher quality protein with appropriate membrane insertion capabilities.

  • Mammalian cell lines such as HEK293 or CHO cells can be effective, especially when studying protein-protein interactions within the SDH complex.

  • Avian cell lines derived from chicken embryonic fibroblasts can provide the most native-like environment for expression studies .

When selecting an expression system, researchers should consider their downstream applications—structural studies may prioritize quantity and purity, while functional assays require properly folded and assembled protein complexes.

How can site-directed mutagenesis be utilized to study SDHD function in chicken models?

Site-directed mutagenesis represents a powerful approach for investigating structure-function relationships in chicken SDHD. Based on established protocols, researchers can implement the following methodological strategy:

  • Target Selection Strategy:

    • Focus on conserved residues identified from alignments of SDHD sequences across species (e.g., D129)

    • Prioritize residues predicted to participate in ubiquinone binding based on homology modeling

    • Include positions involved in SDHD-SDHC interactions that maintain complex stability

  • Mutagenesis Protocol:

    • Q5 or QuikChange site-directed mutagenesis using overlapping primers containing the desired mutation

    • For multiple mutations, use sequential mutagenesis or Gibson Assembly methods

    • Verify all constructs by complete sequencing of the SDHD gene to confirm only intended mutations are present

  • Functional Analysis Methods:

    • Enzymatic activity assays measuring succinate-dependent reduction of artificial electron acceptors (e.g., DCPIP)

    • Polarographic oxygen consumption measurements to assess integration into respiratory chain

    • Differential scanning fluorimetry to analyze protein stability changes induced by mutations

    • Blue native PAGE to examine complex assembly with other SDH subunits

  • In Vivo Approaches:

    • Generation of transgenic chicken models using CRISPR/Cas9 genome editing

    • Development of recombinase-mediated gene cassette exchange (RMCE) systems for chicken cell lines, utilizing Flipase (Flp) recognition target (FRT) pairs integrated into the chicken genome via piggyBac transposition

    • Analysis of mitochondrial morphology and function in cells expressing mutant SDHD using high-resolution microscopy and respirometry

This systematic approach enables researchers to correlate specific amino acid residues with discrete aspects of SDHD function, providing insights into both basic biology and potential disease mechanisms .

What protein purification strategies yield the highest purity and stability for recombinant chicken SDHD?

Purification of recombinant chicken SDHD presents unique challenges due to its hydrophobic nature and requirement for membrane integration. A comprehensive purification strategy should include:

Initial Extraction and Solubilization:

  • Harvest cells and isolate mitochondrial fraction through differential centrifugation (600×g to remove nuclei, followed by 10,000×g to pellet mitochondria)

  • Solubilize membranes using mild detergents - optimal results are typically achieved with:

    • 1-2% digitonin for preserving protein-protein interactions

    • 0.5-1% n-dodecyl-β-D-maltoside (DDM) for higher yield

    • 1% lauryl maltose neopentyl glycol (LMNG) for enhanced stability

Chromatographic Purification Sequence:

  • Immobilized metal affinity chromatography (IMAC) using Ni-NTA or TALON resin for His-tagged SDHD

  • Size exclusion chromatography using Superdex 200 to separate monomeric SDHD from aggregates and other proteins

  • Ion exchange chromatography (typically cation exchange at pH 6.5) as a polishing step

Stability Enhancement Measures:

  • Maintain 0.05-0.1% detergent throughout all purification steps to prevent aggregation

  • Include 10-15% glycerol in all buffers to enhance protein stability

  • Add cardiolipin (0.05-0.1 mg/ml) to mimic the native mitochondrial membrane environment

  • Consider amphipol or nanodisc reconstitution for long-term storage and functional studies

Quality Control Metrics:

  • Assess purity using SDS-PAGE (>95% purity required for most applications)

  • Confirm identity via western blotting and mass spectrometry

  • Verify functional integrity through SDH activity assays measuring succinate-dependent reduction of artificial electron acceptors

  • Evaluate oligomeric state using blue native PAGE or analytical ultracentrifugation

For studies requiring assembly of the complete SDH complex, co-expression of all four subunits followed by tandem affinity purification has proven most effective for obtaining the functional tetramer.

How can recombinant chicken SDHD be utilized in studying mitochondrial remodeling during cellular differentiation?

Mitochondrial remodeling is a critical process during cellular differentiation, particularly in cells with high energy demands. Recombinant chicken SDHD can serve as a valuable tool for studying this phenomenon through several methodological approaches:

  • Tracking SDH Complex Assembly During Differentiation:

    • Generate fluorescently-tagged recombinant chicken SDHD (e.g., GFP fusion) for live-cell imaging

    • Implement pulse-chase experiments with differentially labeled SDHD to monitor turnover rates during differentiation stages

    • Apply proximity ligation assays to quantify interactions between SDHD and other respiratory complex components during mitochondrial maturation

  • Analytical Methods for Mitochondrial Membrane Reorganization:

    • Utilize super-resolution microscopy (STORM/PALM) with labeled recombinant SDHD to visualize cristae remodeling

    • Perform correlative light and electron microscopy (CLEM) to link SDHD distribution with ultrastructural changes

    • Apply quantitative tomographic analysis to measure cristae density and morphology in relation to SDHD expression

  • Functional Consequences of Mitochondrial Remodeling:

    • Compare ATP production capacity using luminescence-based assays in cells expressing wild-type versus mutant SDHD

    • Measure oxygen consumption rates via high-resolution respirometry at different differentiation stages

    • Assess mitochondrial membrane potential using potential-sensitive dyes in conjunction with SDHD expression analysis

Recent studies have demonstrated that mitochondrial remodeling during stem cell differentiation endows mitochondria with enhanced capacity to generate ATP, which is essential for specialized cellular functions . By manipulating recombinant chicken SDHD expression or introducing specific mutations, researchers can directly investigate how Complex II contributes to this remodeling process and the subsequent impacts on ATP generation capacity.

This approach is particularly valuable when studying how impaired mitochondrial remodeling may trigger stress responses, such as endoplasmic reticulum (ER) stress and activation of the Integrated Stress Response (ISR), which have been linked to cell death during differentiation .

What insights can be gained by comparing wild-type and mutant forms of chicken SDHD in relation to enzyme stability and function?

Comparative analysis of wild-type and mutant forms of chicken SDHD provides crucial insights into structure-function relationships and potential disease mechanisms. Key methodological approaches include:

Stability Analysis:

  • Cycloheximide chase assays to measure protein half-life, as demonstrated with human SDHD mutants showing reduced stability compared to wild-type protein

  • Proteasome inhibition studies using MG132 to determine if mutant SDHD degradation occurs through the ubiquitin-proteasome pathway

  • Thermal shift assays to quantify changes in protein thermal stability resulting from specific mutations

Enzymatic Function Assessment:

  • Spectrophotometric assays measuring succinate-dependent reduction of artificial electron acceptors (DCPIP) or natural acceptors (ubiquinone)

  • Polarographic determination of oxygen consumption rates in isolated mitochondria or permeabilized cells

  • Analysis of electron transfer efficiency through the iron-sulfur clusters using electron paramagnetic resonance (EPR) spectroscopy

Qp Site Binding Studies:

  • Competitive binding assays with known SDH inhibitors to identify altered binding characteristics in mutant proteins

  • Isothermal titration calorimetry (ITC) to determine thermodynamic parameters of substrate binding

  • Homology modeling and molecular docking studies to predict structural changes affecting ubiquinone interaction

Studies with mutant SDHD proteins have revealed:

  • Mutations can significantly impact protein stability, often leading to increased proteasomal degradation

  • Even mutations with greatly reduced SDH activity can still establish resistance to SDH inhibitors in vivo, suggesting minimal activity is sufficient for viability

  • Specific mutations in the Qp site can display selectivity toward structurally distinct SDH inhibitors

This comparative approach has revealed that SDHD mutations affecting the Qp site not only impact enzyme function but can also influence the biology of the organism as demonstrated by altered virulence in certain pathogens .

How does SDHD function contribute to reactive oxygen species (ROS) generation and management in mitochondria?

The relationship between SDHD function and reactive oxygen species (ROS) in mitochondria represents an important area of study with implications for cellular health and disease pathogenesis. While SDH is not typically considered a major site for ROS production in the electron transport chain, emerging evidence suggests important connections:

Mechanisms of ROS Generation Associated with SDHD:

  • Electron Leakage Pathways:

    • During normal catalysis, electrons flow from succinate through FAD and iron-sulfur clusters to ubiquinone

    • Mutations or dysfunction in SDHD can disrupt the ubiquinone binding pocket geometry, potentially increasing electron leakage to oxygen

    • The semiquinone radical formed during ubiquinone reduction is particularly vulnerable to side reactions with oxygen when the catalytic cycle is impaired

  • Experimental Methods for Measuring SDH-Related ROS:

    • Amplex Red assays to quantify H₂O₂ production in isolated mitochondria with specific substrates and inhibitors

    • MitoSOX Red fluorescence microscopy and flow cytometry to measure mitochondrial superoxide production

    • EPR spin-trapping techniques using DMPO or DEPMPO for specific radical identification

    • Genetically encoded redox sensors (roGFP2) targeted to mitochondria for real-time ROS monitoring

  • ROS Consequences and Signaling:

    • Accumulated ROS from dysfunctional SDH may act as signaling molecules that inhibit HIFα prolyl hydroxylase activity, leading to pseudo-hypoxic responses under normoxic conditions

    • ROS-mediated DNA damage, both mitochondrial and nuclear, has been linked to genomic instability and potential tumorigenesis

    • Oxidative damage to other mitochondrial proteins can initiate a vicious cycle of increasing dysfunction

Interestingly, contrary to some theoretical predictions, experimental evidence using homologous recombinant strains carrying Qp site mutations has shown that these mutations did not significantly impact ROS production in vivo in certain organisms . This suggests that the relationship between SDHD mutations and ROS generation may be species-specific or context-dependent, highlighting the need for careful experimental design when studying these phenomena.

What gene editing approaches are most effective for modifying SDHD in chicken systems?

Genetic modification of SDHD in chicken systems requires specialized approaches optimized for avian biology. Current methodologies with demonstrated success include:

CRISPR/Cas9-Based Approaches:

  • Design Considerations:

    • sgRNA selection should prioritize sites with minimal off-target potential across the chicken genome

    • PAM site availability may be limiting; consider using alternative Cas variants (Cas12a/Cpf1) if necessary

    • Homology-directed repair (HDR) templates should include >800bp homology arms for optimal efficiency

  • Delivery Methods:

    • For cell culture: nucleofection of ribonucleoprotein complexes achieves higher efficiency than plasmid transfection

    • For embryos: direct injection into stage X embryos using window or shell-less culture systems

    • For primordial germ cells (PGCs): electroporation followed by selection and reimplantation

Recombinase-Mediated Gene Cassette Exchange (RMCE):
This approach has been specifically validated in chicken models and offers several advantages:

  • Allows for precise replacement of gene segments once targeting sites are established

  • Utilizes Flipase (Flp) recognition target (FRT) pairs integrated into the chicken genome

  • Integration can be mediated efficiently by piggyBac transposition

  • Enables consistent expression levels by targeting the same genomic locus repeatedly

Transgene Integration Strategies:

  • piggyBac Transposition:

    • Demonstrated high efficiency in chicken systems

    • Results in diverse integration patterns that affect expression levels across tissues

    • Allows for selection of lines with optimal SDHD expression profiles

  • Targeted Integration:

    • Integration at specific loci supports robust and predictable expression levels

    • Customized expression of functional proteins at predetermined levels

    • Minimizes epigenetic influence on transgene expression

Notably, these approaches have facilitated the production of transgenic chicken lines with modified genomic loci that enable consistent and predictable expression of integrated genes. This technology is particularly valuable for studies requiring precise control over SDHD expression or the introduction of specific mutations to investigate structure-function relationships .

How can transgenic chicken models be established to study SDHD mutations associated with mitochondrial disorders?

Establishing transgenic chicken models to study SDHD mutations requires a comprehensive strategy encompassing multiple molecular and developmental techniques:

Model Design Strategy:

  • Target Mutation Selection:

    • Prioritize mutations with clear human disease associations

    • Include mutations affecting conserved residues across species (e.g., D129 equivalent)

    • Consider a range of mutation types: catalytic site mutations, stability-affecting mutations, and assembly-disrupting mutations

  • Expression Control Systems:

    • Inducible expression systems (e.g., tetracycline-regulated) prevent embryonic lethality if mutations severely impact mitochondrial function

    • Tissue-specific promoters allow targeting of SDHD mutations to relevant tissues (e.g., neural crest derivatives for paraganglioma models)

Primordial Germ Cell (PGC) Modification Pathway:

  • Isolate chicken PGCs from embryonic blood or gonads at stages HH14-17

  • Introduce SDHD mutations using CRISPR/Cas9 or homologous recombination

  • Verify modifications through sequencing and functional assays in cultured PGCs

  • Expand verified PGC clones in culture supplemented with growth factors (FGF, SCF)

  • Inject modified PGCs into the bloodstream of stage HH14-17 recipient embryos

  • Raise chimeric embryos to sexual maturity

  • Screen for germline transmission by breeding chimeric roosters with wild-type hens

Direct Embryo Modification Alternative:

  • Deliver CRISPR/Cas9 components targeting SDHD directly to stage X embryos

  • Culture manipulated embryos to hatch using surrogate shell cultures

  • Screen hatchlings for desired mutations and establish founder lines

  • Breed to homozygosity if mutation permits viability

Phenotypic Characterization Framework:

  • Biochemical Analysis:

    • Measure SDH enzyme activity in relevant tissues

    • Assess succinate/fumarate ratios using metabolomics

    • Evaluate mitochondrial respiratory capacity through high-resolution respirometry

  • Physiological Assessment:

    • Monitor growth rates and development milestones

    • Perform tissue-specific functional tests based on known human disease manifestations

    • Evaluate stress responses and adaptations to metabolic challenges

  • Molecular Phenotyping:

    • Transcriptomic profiling to identify compensatory pathways

    • Proteomic analysis of mitochondrial composition

    • Evaluation of HIF pathway activation and downstream targets

The establishment of site-specific recombination technologies in chicken models, particularly through Flipase (Flp) recognition target (FRT) pairs mediated by piggyBac transposition, provides a valuable platform for developing these disease models with consistent gene expression patterns .

What bioinformatic tools are most useful for analyzing SDHD sequence conservation and predicting functional impacts of mutations?

Comprehensive bioinformatic analysis of SDHD requires a multi-tiered approach leveraging various computational tools. The following framework provides a systematic methodology for researchers:

Sequence Conservation Analysis:

  • Multiple Sequence Alignment (MSA) Tools:

    • MUSCLE or MAFFT for initial alignment of SDHD sequences across species

    • T-Coffee for more refined alignments incorporating structural information

    • PRALINE for transmembrane protein-specific alignments, critical for the membrane-bound SDHD

  • Conservation Scoring Methods:

    • ConSurf server for mapping conservation onto structural models with Bayesian inference

    • Rate4Site algorithm for identifying functionally important residues based on evolutionary rates

    • Jensen-Shannon divergence analysis to identify subtype-specific conservation patterns

Structural Analysis and Mutation Impact Prediction:

  • Homology Modeling:

    • SWISS-MODEL or I-TASSER for generating chicken SDHD structural models based on existing SDH crystal structures

    • MODELLER for incorporating constraints from experimental data

    • QMEANBrane specifically for the transmembrane regions of SDHD

  • Mutation Effect Predictors:

    • PROVEAN and SIFT for assessing evolutionary conservation-based impacts

    • PolyPhen-2 for structure-based prediction of mutation effects

    • DUET for integrating stability and interaction effects of mutations

    • FoldX for calculating changes in protein stability (ΔΔG)

  • Molecular Dynamics Simulations:

    • GROMACS with specialized membrane protein force fields

    • Analysis protocols focusing on:

      • Ubiquinone binding site geometry changes

      • Alterations in interactions with other SDH subunits

      • Membrane integration stability

Functional Network Analysis:

  • Protein-Protein Interaction Tools:

    • STRING-db for identifying functional partners of SDHD

    • PSICQUIC for curating experimental interaction data

  • Pathway Analysis:

    • Reactome for metabolic pathway integration

    • MitoMiner for mitochondria-specific functional networks

  • Expression Correlation Analysis:

    • COXPRESdb for identifying genes co-expressed with SDHD across tissues

    • PathwayCommons for integrating expression with functional pathways

For chicken SDHD specifically, comparative analysis across avian species can identify lineage-specific conserved features that may relate to the unique metabolic demands of flying animals.

What are the most common challenges in working with recombinant chicken SDHD and how can they be addressed?

Researchers working with recombinant chicken SDHD frequently encounter several technical challenges. The following methodological approaches address these common obstacles:

Challenge 1: Low Expression Yields

Problem Analysis: The hydrophobic nature of SDHD as a transmembrane protein often leads to poor expression, protein aggregation, or inclusion body formation.

Solution Strategy:

  • Expression System Optimization:

    • Compare E. coli strains specialized for membrane proteins (C41(DE3), C43(DE3), or Lemo21(DE3))

    • Test expression in eukaryotic systems (insect cells or chicken cell lines) for improved folding

    • Optimize induction conditions: reduce temperature to 16-18°C, decrease inducer concentration, and extend expression time

  • Fusion Tag Selection:

    • Implement solubility-enhancing tags: MBP, SUMO, or TrxA at the N-terminus

    • Test dual tagging approaches: N-terminal solubility tag and C-terminal purification tag

    • Include short linker sequences (GGGGS)₃ between SDHD and tags to minimize interference

  • Media and Additive Optimization:

    • Supplement with membrane-mimetic compounds (0.05% Brij-35 or 0.1% Triton X-100)

    • Add chemical chaperones (5% sorbitol, 2.5% glycerol) to culture media

    • Include specific lipids that may stabilize membrane protein folding

Challenge 2: Protein Instability and Aggregation

Problem Analysis: SDHD often shows poor stability when extracted from its native membrane environment, leading to rapid degradation or aggregation.

Solution Strategy:

  • Stabilizing Buffer Development:

    • Systematic screening of buffer conditions using differential scanning fluorimetry

    • Empirically determined optimal conditions: typically 25mM Tris-HCl pH 7.5, 150mM NaCl, 10% glycerol, 0.05% DDM

    • Addition of specific lipids: cardiolipin (0.5-1mg/ml) significantly improves stability of mitochondrial membrane proteins

  • Detergent Selection Matrix:

    DetergentConcentrationAdvantagesLimitations
    DDM0.05-0.1%Good general solubilizationMay destabilize over time
    LMNG0.01-0.02%Superior stabilityExpensive, slower extraction
    Digitonin0.5-1%Maintains complex integrityPoor batch consistency
    GDN0.01-0.05%Enhanced stabilityLimited availability
  • Alternative Membrane Mimetics:

    • Reconstitution into nanodiscs using MSP1D1 and POPC/POPE/cardiolipin mixtures

    • Application of SMALPs (styrene maleic acid lipid particles) for detergent-free extraction

    • Amphipol A8-35 for long-term stability in detergent-free environment

Challenge 3: Poor Complex Assembly with Other SDH Subunits

Problem Analysis: Recombinant SDHD often fails to assemble properly with other SDH subunits, limiting functional studies.

Solution Strategy:

  • Co-expression Approaches:

    • Design polycistronic constructs expressing all four SDH subunits with optimized spacing

    • Implement dual-vector systems with compatible origins for co-transformation

    • Sequential induction strategy: express anchor subunits (SDHC/SDHD) first, followed by catalytic subunits

  • In vitro Reconstitution Protocol:

    • Purify individual subunits under optimized conditions for each

    • Combine in specific order: SDHC+SDHD first to form membrane anchor, then add SDHB, finally SDHA

    • Include cardiolipin and ubiquinone analogs during reconstitution

    • Verify assembly by blue native PAGE and activity assays

  • Verification Methods:

    • Size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS)

    • Analytical ultracentrifugation to confirm complex stoichiometry

    • Functional enzyme assays measuring electron transfer from succinate to ubiquinone

These systematic approaches significantly improve success rates when working with recombinant chicken SDHD, enabling more robust experimental outcomes for both structural and functional studies.

What are the best practices for designing SDH activity assays using recombinant chicken SDHD?

Designing robust and reproducible assays for SDH activity using recombinant chicken SDHD requires careful consideration of multiple factors. The following comprehensive methodological framework ensures reliable results:

Enzyme Source Preparation Options:

  • Purified Recombinant Complex:

    • Full reconstitution of all four SDH subunits provides the most controlled system

    • Requires co-expression or reconstitution from separately purified subunits

    • Must be stabilized in appropriate detergent or membrane mimetic

  • Membrane Fractions:

    • Isolated mitochondrial membranes from cells expressing recombinant chicken SDHD

    • Preserves native lipid environment and associated factors

    • Contains endogenous electron transport chain components for coupled assays

  • Whole Mitochondria:

    • Isolated using differential centrifugation and density gradient purification

    • Maintains structural integrity and coupling between respiratory complexes

    • Requires permeabilization for substrate access in some assay formats

Spectrophotometric Assay Systems:

  • Artificial Electron Acceptor Reduction:

    Electron AcceptorWorking ConcentrationAbsorption WavelengthAdvantages/Limitations
    DCPIP50-100 μM600 nmHigh sensitivity, potential for direct interference
    PMS-coupled MTTPMS (100 μM), MTT (50 μM)570 nmLess prone to interference, two-step reaction
    Ferricyanide1 mM420 nmStable, but lower sensitivity

    Protocol Optimization Parameters:

    • Buffer composition: 50 mM phosphate buffer (pH 7.4) with 0.1 mM EDTA

    • Substrate concentration: 10-20 mM succinate (pre-incubate to activate enzyme)

    • Temperature optimization: typically 30°C for chicken proteins

    • Control for non-specific reduction: use malonate (10 mM) as specific SDH inhibitor

  • Ubiquinone Reduction Monitoring:

    • Direct measurement of CoQ reduction at 275 nm (requires anaerobic conditions)

    • Coupled assays with cytochrome c reduction (via Complex III) at 550 nm

    • Use of fluorescent ubiquinone analogs for enhanced sensitivity

Polarographic/Oxygen Consumption Methods:

  • High-Resolution Respirometry:

    • Measures oxygen consumption using sensitive Clark-type electrodes or optical sensors

    • Sequential substrate/inhibitor addition protocol:

      • Add sample in respiratory buffer (110 mM sucrose, 60 mM K-lactobionate, 0.5 mM EGTA, 3 mM MgCl₂, 20 mM taurine, 10 mM KH₂PO₄, 20 mM HEPES, pH 7.1)

      • Establish baseline respiration

      • Add succinate (10 mM) to initiate SDH-dependent respiration

      • Add rotenone (0.5 μM) to inhibit Complex I contribution

      • Add malonate (10 mM) to specifically inhibit SDH and establish specificity

    • Calculate SDH-specific oxygen consumption rate from the malonate-sensitive component

Critical Controls and Validation:

  • Enzyme Concentration Linearity:

    • Perform activity measurements across a range of enzyme concentrations

    • Ensure linearity of reaction rate vs. enzyme concentration

    • Determine optimal working range for different assay formats

  • Substrate Kinetics Characterization:

    • Determine Km for succinate (typically 0.1-0.5 mM)

    • Assess product (fumarate) inhibition profiles

    • Evaluate quinone acceptor affinity if using native electron acceptors

  • Inhibitor Controls:

    • Malonate (competitive inhibitor): IC₅₀ typically 1-5 mM

    • Carboxin or other site-specific inhibitors: useful for Qp site integrity assessment

    • Atpenin derivatives: highly potent SDH inhibitors for complete inhibition controls

These methodological approaches ensure that SDH activity assays using recombinant chicken SDHD provide reliable, reproducible, and physiologically relevant measurements of enzyme function, enabling accurate assessment of wild-type and mutant forms of the protein.

How is SDHD research contributing to our understanding of mitochondrial diseases?

SDHD research has become increasingly valuable for understanding the molecular mechanisms underlying mitochondrial diseases, particularly those involving energy metabolism. Current methodological approaches are advancing our understanding in several key areas:

Pathogenic Mechanisms of SDHD Mutations:

Mutations in SDHD are known to contribute to several human diseases, particularly paragangliomas (PGL). Research with recombinant SDHD proteins, including studies in model organisms, has revealed multiple mechanisms by which SDHD dysfunction leads to pathology:

  • Protein Stability Mechanisms:
    Research has demonstrated that many SDHD mutations result in reduced protein stability and increased degradation through the ubiquitin-proteasome pathway. Experiments using cycloheximide chase assays and proteasome inhibitors (MG132) have confirmed that mutant SDHD proteins often show dramatically reduced half-lives compared to wild-type protein .

  • Metabolic Reprogramming Pathways:
    SDHD dysfunction leads to succinate accumulation, which inhibits α-ketoglutarate-dependent dioxygenases including histone demethylases and prolyl hydroxylases. This inhibition results in hypermethylation of histones and stabilization of hypoxia-inducible factor α (HIFα) under normoxic conditions (pseudo-hypoxia) .

  • ROS-Mediated Pathologies:
    While Complex II is not typically considered a major site for ROS production, accumulating evidence suggests that SDHD mutations can increase oxidative stress, leading to nuclear genomic instability and potentially contributing to tumorigenesis .

Methodological Advances in Disease Modeling:

Recent technological developments have enhanced our ability to model SDHD-related diseases:

  • Patient-Derived Models:
    The advent of iPSC technology allows for the generation of patient-specific cellular models harboring native SDHD mutations, enabling direct comparison with isogenic corrected controls.

  • Recombinant Expression Systems:
    Avian systems provide unique advantages for studying SDHD, as demonstrated by the development of transgenic chicken models using site-specific recombination technologies like Flipase (Flp) recognition target (FRT) systems .

  • Genome Editing Applications:
    CRISPR/Cas9-mediated homologous recombination enables the introduction of specific SDHD mutations in relevant model systems, allowing for clean comparison of biochemical factors affecting mitochondrial function without confounding genomic variables .

Functional Complementation Studies:

Research has demonstrated interesting functional relationships between SDHD and its homologs in model organisms. For example, studies in yeast have shown that Shh4, a conserved homolog of the originally discovered SDHD subunit Sdh4, can be induced to rescue mitochondrial damage in sdh4Δ cells. This complementation demonstrates evolutionary conservation of function and provides important insights into potential compensatory mechanisms that might be therapeutically relevant .

These research directions are collectively expanding our understanding of how SDHD dysfunction contributes to mitochondrial diseases and are identifying potential intervention points for future therapeutic development.

What are the emerging techniques for studying interactions between SDHD and other mitochondrial proteins?

Investigation of protein-protein interactions involving SDHD has been revolutionized by several emerging technologies that offer unprecedented resolution and insight into mitochondrial protein complexes. These cutting-edge methodological approaches include:

Proximity-Based Labeling Technologies:

  • BioID and TurboID Methods:

    • Fusion of biotin ligase (BirA* or TurboID) to SDHD enables biotinylation of proximal proteins

    • Spatially-resolved interactome mapping within mitochondrial membranes

    • Comparative workflow between wild-type and mutant SDHD reveals differential interaction networks

    • Quantitative proteomics of biotinylated proteins using LC-MS/MS identifies both stable and transient interactions

  • APEX2 Proximity Labeling:

    • SDHD-APEX2 fusion catalyzes localized biotinylation upon brief H₂O₂ exposure

    • Millisecond-scale temporal resolution captures dynamic interactions

    • Can be combined with mitochondrial sub-compartment targeting for spatial resolution

    • Compatible with both biochemical enrichment and imaging approaches

Advanced Imaging Techniques:

  • Super-Resolution Microscopy:

    • Structured illumination microscopy (SIM) achieves ~100 nm resolution of labeled SDHD interactions

    • STORM/PALM approaches enable visualization of individual SDHD molecules within mitochondrial membranes

    • Expansion microscopy physically enlarges mitochondrial structures for enhanced resolution

    • Quantitative co-localization analysis with respiratory chain components and assembly factors

  • Förster Resonance Energy Transfer (FRET):

    • SDHD fused to donor fluorophores (mTurquoise2) with acceptor-tagged interaction partners

    • Live-cell monitoring of protein interactions with nanometer precision

    • Spectral FRET imaging allows multiplexed analysis of multiple interaction pairs

    • FLIM-FRET (Fluorescence Lifetime Imaging Microscopy) provides quantitative interaction measurements independent of fluorophore concentration

Structural Biology Approaches:

  • Cryo-Electron Microscopy:

    • Single-particle cryo-EM of purified SDH complex achieves near-atomic resolution

    • Subtomogram averaging of mitochondrial membranes reveals SDHD in native context

    • Visualizes interactions between SDHD and other respiratory complexes in respiratory supercomplexes

    • Structure-guided mutagenesis to validate interaction interfaces

  • Integrative Structural Modeling:

    • Combines data from X-ray crystallography, NMR, crosslinking mass spectrometry (XL-MS)

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) maps interaction surfaces

    • Computational docking refined by experimental constraints

    • Molecular dynamics simulations of SDHD interactions within membrane environment

Functional Interaction Assessment:

  • Genetic Interaction Mapping:

    • CRISPR interference/activation screens in combination with SDHD perturbation

    • Synthetic lethality profiles reveal functional interaction networks

    • Suppressor screens identify compensatory pathways for SDHD dysfunction

  • Respiratory Chain Complex Assembly Analysis:

    • Blue native PAGE coupled with in-gel activity assays

    • Pulse-chase experiments with stable isotope labeling to track assembly kinetics

    • Serial immunodepletion to identify assembly intermediates containing SDHD

    • Quantitative analysis of complex assembly efficiency in presence of wild-type versus mutant SDHD

These technologies have revealed that SDHD interacts not only with other SDH subunits but also with assembly factors, respiratory chain components, and potentially membrane lipids that are critical for proper mitochondrial function. The application of these methods to chicken SDHD will provide valuable comparative data on the conservation of these interaction networks across species.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.