Recombinant Chicken Sulfhydryl oxidase 1 (QSOX1)

Shipped with Ice Packs
In Stock

Description

Enzymatic Activity and Kinetics

Recombinant QSOX1 demonstrates high catalytic efficiency toward unfolded proteins and small-molecule thiols. Key findings include:

Substrate Specificity

SubstrateActivity (Relative to RNase A)NotesSource
Reduced RNase AHigh (Km = 110–330 μM)Preferred substrate for disulfide formation
Dithiothreitol (DTT)ModerateUsed in biochemical assays
GlutathioneLow (micromolar concentrations)Limited physiological relevance

Mechanistic Insights

QSOX1 operates via a disulfide relay mechanism:

  1. Thiol oxidation: TRX domain oxidizes substrate thiols.

  2. Electron transfer: Reduced TRX domain transfers electrons to the FAD-bound ERV1 domain.

  3. Oxygen reduction: FADH₂ reduces molecular oxygen to H₂O₂ .

Role in Protein Folding and ECM Modulation

QSOX1 is critical for laminin incorporation into the extracellular matrix (ECM), ensuring proper cell adhesion and migration . In fibroblasts, its depletion leads to detached cells and reduced ECM integrity .

Cancer-Associated Functions

While most studies focus on human QSOX1, analogous roles are inferred for chicken homologs:

Cancer TypeObserved EffectMechanismSource
Breast/Lung/PancreaticPromotes tumor growth and invasionECM remodeling, ROS generation
ProstateLinked to metastasis and poor prognosisDisulfide-dependent signaling

Therapeutic Targeting

Ebselen, a selenium-containing compound, inhibits QSOX1 activity and suppresses tumor invasion in preclinical models .

Challenges and Knowledge Gaps

  • Limited Recombinant Data: Most studies use avian egg-derived QSOX1 or human recombinant variants. Data on chicken-specific recombinant QSOX1 is sparse.

  • Oxidative Stress Paradox: QSOX1-generated ROS may drive genomic instability while also promoting survival signaling pathways .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for custom preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting to -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
Note: If a specific tag type is required, please inform us for preferential development.
Synonyms
QSOX1; QSCN6; QSOX; SOX; Sulfhydryl oxidase 1; Quiescin Q6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
43-743
Protein Length
Full Length of Mature Protein
Species
Gallus gallus (Chicken)
Target Names
QSOX1
Target Protein Sequence
RSLYSPSDPLELLGADTAERRLLGSPSAWAVEFFASWCGHCIHFAPTWRALAEDVREWRP AVMIAALDCADEANQQVCADFGITGFPTLKFFRAFSKKAEDGIRIAHPTATVADLRRAII TNLEQSGDAWPPACPPLEPASAEEVRSFFHRNTERYLALIFEQSNSFVGREVALDLLQYE NVAVRRVLSSEEELVEKFGVTTFPSAYLLLRNGSFSRLPVHAEARSFYTYYLQTLSGVTR GSYRLNVTGSAINETRALQPAQADRSKVYVADLESTVHYTLRVEAGRPAVLAGAQLAALK CYVATLAKYFPGRPSVQTFLQSLDSWLRNWTEPELPRSALKEAVKNKEDASPAAVLPTNV TWVGCRGSEPHFRGYPCGLWTIFHLLTVQAAQGGPDEELPLEVLNTMRCYVKHFFGCQEC AQHFEAMAAKSMDQVKSRREAVLWLWSHHNEVNARLAGGDTEDPQFPKLQWPPPDMCPQC HREERGVHTWDEAAVLSFLKEHFSLGNLYLDHAIPIPMAGEEAAASARLSTAGLREKEEE ERKEEEEEGEKETEKPHREGETGRPGSSELRRPSIVRRNPRLRALGEDIVDLDSFSEQHF KSKALRAAGRHRRLSKRDTVALHHDAGWERLQVPESREEEEEGGVLRRSPWLRVLGLGFS RLDVSLCIALYFLSSMCLLGMYTFFRLRTRARKGRPGFPVA
Uniprot No.

Target Background

Function

Recombinant Chicken Sulfhydryl oxidase 1 (QSOX1) catalyzes the oxidation of sulfhydryl groups in peptide and protein thiols to disulfides, simultaneously reducing oxygen to hydrogen peroxide. It plays a crucial role in disulfide bond formation in various extracellular proteins. In fibroblasts, QSOX1 is essential for the proper incorporation of laminin into the extracellular matrix, thus contributing to normal cell-cell adhesion and cell migration.

Database Links

KEGG: gga:373914

UniGene: Gga.148

Protein Families
Quiescin-sulfhydryl oxidase (QSOX) family
Subcellular Location
Golgi apparatus membrane; Single-pass membrane protein. Secreted.

Q&A

What is QSOX1 and what is its enzymatic activity?

QSOX1 is a flavoprotein enzyme that catalyzes the oxidation of thiols to disulfides during protein folding. It rapidly inserts disulfide bonds into unfolded, reduced proteins while simultaneously reducing molecular oxygen to hydrogen peroxide. The enzyme demonstrates a high efficiency for protein substrates (Km=110–330 μM/thiol) and shows a marked preference for protein substrates over small mono- and di-thiol containing molecules . QSOX1 appears to function in cooperation with protein disulfide isomerase (PDI) during the protein folding process, with QSOX1 oxidizing protein thiols while PDI iteratively refolds proteins into their native state via redox shuffling .

What experimental systems are suitable for studying QSOX1?

The heterologous expression of QSOX1 has been successfully achieved in multiple systems. For recombinant human QSOX1, expression in bacterial systems has yielded functional enzyme suitable for enzymatic characterization . Cell culture models using breast cancer cells (MCF-7, MDA-MB-231), pancreatic cancer cells (PANC-1), and prostate cancer cell lines have also proven valuable for studying QSOX1's cellular functions . Additionally, polyacrylamide gel systems with variable stiffness have been employed to investigate how mechanical properties influence QSOX1 expression . When designing experiments, researchers should consider that QSOX1 exists in multiple isoforms (long and short), with the short form lacking the transmembrane region found in the long form .

How can site-directed mutagenesis be applied to investigate QSOX1 catalytic mechanism?

Site-directed mutagenesis represents a powerful approach for dissecting the catalytic mechanism of QSOX1. This technique has been successfully applied to create single Cys-to-Ala or -Ser mutants for all six conserved cysteine residues in human QSOX1, as well as SxxS double mutants . The analysis of these mutants revealed that the four cysteine residues C70, C73, C449, and C452 are crucial for efficient oxidation of reduced proteins like RNase . Surprisingly, experiments with mutant human QSOX1 indicated that the conserved distal C509–C512 disulfide is dispensable for the oxidation of reduced RNase or dithiothreitol . This finding contradicted previous mechanistic models proposed for avian QSOX, demonstrating how site-directed mutagenesis can fundamentally revise our understanding of enzyme mechanisms.

What are the optimal assay conditions for measuring QSOX1 activity?

QSOX1 activity can be measured using various reduced substrates, with the enzyme showing different kinetic parameters depending on the substrate. Common substrates include dithiothreitol (DTT), reduced ribonuclease A (RNase), and reduced glutathione (GSH). The enzyme shows a >100-fold lower kcat/Km for reduced glutathione compared to other substrates . For recombinant human QSOX1, typical kcat values range from 1000-4000/min, comparable to non-recombinant avian and bovine QSOXs .

SubstrateTypical ConcentrationRelative ActivityDetection Method
DTT5 mMHighO₂ consumption or H₂O₂ production
Reduced RNase38 μMHighO₂ consumption or H₂O₂ production
GSHMillimolar rangeLow (>100-fold lower kcat/Km)O₂ consumption or H₂O₂ production

Activity assays should be designed to account for the enzyme's preference for protein substrates and consider that hydrogen peroxide is produced as a byproduct of the enzymatic reaction .

How can QSOX1 expression be modulated in experimental systems?

Several approaches have been successfully employed to modulate QSOX1 expression:

  • RNA interference: Short hairpin RNA (shRNA) in lentiviral vectors has been used to stably knock down QSOX1 in pancreatic and breast tumor cell lines, resulting in growth rates less than 30% of controls and decreased invasive capacity .

  • Heterologous overexpression: MCF-7 cells engineered to overexpress QSOX1 showed protection against oxidative stress-induced apoptosis .

  • Recombinant protein supplementation: Addition of recombinant QSOX1 protein to culture media rescued the invasive phenotype in shQSOX1-transduced breast tumor cell lines .

  • Matrix stiffness modulation: Polyacrylamide gels with elastic moduli representing the pathological range of human pancreatic ductal adenocarcinoma (2-60 kPa) have been used to investigate how mechanical properties influence QSOX1 expression .

When implementing these approaches, researchers should consider potential confounding factors. For instance, hydrogen peroxide is naturally produced as a result of QSOX1 enzymatic activity, which may complicate the interpretation of oxidative stress experiments .

What is the role of QSOX1 in cancer progression?

QSOX1 has been reported to be overexpressed in multiple cancer types, including breast, pancreatic, and prostate cancers . The function of QSOX1 in cancer appears to be context-dependent and potentially contradictory. Several studies indicate that QSOX1 overexpression is important during tumor cell invasion, facilitating tumor cell migration at the tumor-stroma interface . Mechanistically, QSOX1 affects the proteolytic activity of matrix metalloproteinases (MMP-2 and MMP-9) secreted by tumor cells, with QSOX1 silencing decreasing MMP proteolytic activity without affecting MMP mRNA levels .

How does the tumor microenvironment affect QSOX1 expression?

The tumor microenvironment includes both biochemical and mechanical factors that may influence QSOX1 expression. Contrary to expectations, hypoxia (both atmospheric at 1% O₂ and chemical using 400 μM CoCl₂) did not significantly alter QSOX1 gene expression or intracellular protein levels in pancreatic cancer cells . In contrast, matrix stiffness was found to significantly modulate QSOX1 expression, with softer polyacrylamide gel substrates leading to downregulation of QSOX1 compared to stiffer surfaces . This finding suggests that mechanical properties of the tumor microenvironment, rather than oxygen availability, may be primary regulators of QSOX1 expression in cancer.

Microenvironmental FactorEffect on QSOX1Experimental System
Hypoxia (1% O₂)No significant changePancreatic cancer cells
Chemical hypoxia (CoCl₂)No significant changePancreatic cancer cells
Soft matrix (2-10 kPa)Decreased expressionPancreatic cancer cells on PAA gels
Stiff matrix (>40 kPa)Increased expressionPancreatic cancer cells on PAA gels

What is the relationship between QSOX1 and oxidative stress in cancer?

QSOX1 may play a dual role in oxidative stress in cancer contexts. On one hand, QSOX1 enzymatic activity produces hydrogen peroxide as a byproduct, potentially contributing to oxidative stress . On the other hand, some evidence suggests QSOX1 may protect cells against oxidative damage. For instance, MCF-7 cells engineered to overexpress guinea pig QSOX1 showed protection against oxidative stress-induced apoptosis . It remains unclear whether QSOX1 is involved in a positive feedback loop where hydrogen peroxide induces QSOX1 expression, which in turn produces more hydrogen peroxide via enzymatic activity . This complex relationship highlights the need for careful experimental design when investigating QSOX1's role in redox biology.

How should researchers control for potential artifacts in QSOX1 studies?

When investigating QSOX1, several potential artifacts and confounding factors should be controlled:

  • Isoform specificity: QSOX1 exists in both long (QSOX1-L, 747 amino acids) and short (QSOX1-S, 604 amino acids) isoforms, with the short form lacking the transmembrane region . Experiments should specify which isoform is being studied and consider potential functional differences.

  • Species differences: While human and avian QSOX1 share significant homology, structural and functional differences exist. For instance, human QSOX1 is monomeric while avian QSOX1 was previously thought to function as a dimer . When comparing results across species, these differences must be considered.

  • Hydrogen peroxide production: As QSOX1 enzymatic activity produces H₂O₂, experiments investigating oxidative stress should consider this confounding factor .

  • Cell type specificity: QSOX1 expression and function may vary considerably between cell types and cancers. For instance, contradictory findings regarding QSOX1's role in breast cancer highlight the importance of cell line authentication and molecular classification of tumor samples .

What are the key considerations for designing in vivo experiments with QSOX1?

When designing in vivo experiments involving QSOX1, researchers should consider:

  • Model selection: Both genetically engineered mouse models and xenograft experiments have been used to investigate QSOX1 function in vivo . The selection of an appropriate model should be guided by the specific research question.

  • Tissue specificity: QSOX1 expression varies significantly between tissues, and its function may be context-dependent. Studies should account for this variability when interpreting results.

  • Microenvironmental factors: As matrix stiffness influences QSOX1 expression , in vivo experiments should consider how the microenvironment of the experimental model might affect QSOX1 function.

  • Tumor heterogeneity: In cancer studies, researchers should consider that QSOX1 expression may vary within tumors and between patients. Laser capture microdissection has been used to address this by enabling gene expression profiling from specific tumor regions .

How can conflicting findings about QSOX1 in the literature be reconciled?

The literature contains several apparent contradictions regarding QSOX1 function, particularly in cancer contexts. To reconcile these conflicts, researchers should:

  • Consider methodological differences: Variations in experimental techniques, model systems, and analytical approaches may contribute to disparate findings. For instance, conflicts regarding QSOX1's role in breast cancer might stem from differences in cell line authentication or tumor molecular classification .

  • Account for context dependency: QSOX1 function may be highly dependent on cellular context, microenvironment, and disease stage. For example, the relationship between QSOX1 and the tumor suppressor Nkx3.1 in prostate cancer suggests QSOX1 may play different roles at different stages of tumorigenesis .

  • Validate findings across multiple systems: To strengthen confidence in experimental results, findings should be validated using complementary approaches and model systems.

  • Consider isoform-specific effects: The two major QSOX1 isoforms (long and short) may have distinct functions, potentially explaining some contradictory findings .

What unresolved questions remain about QSOX1 mechanism?

Despite significant advances, several mechanistic questions about QSOX1 remain unresolved:

  • The complete electron transfer pathway within the enzyme, particularly given the finding that human QSOX1 is monomeric and can function without the distal disulfide previously thought to be essential .

  • The precise nature of QSOX1's cooperation with PDI and other factors during protein folding in vivo .

  • The substrate specificity determinants that explain QSOX1's preference for certain protein substrates over others.

  • The role of QSOX1 in regulating extracellular matrix composition and structure, particularly in disease contexts .

How might QSOX1 be targeted for therapeutic applications?

The involvement of QSOX1 in cancer progression suggests it might represent a potential therapeutic target. Several approaches could be explored:

  • Small molecule inhibitors of QSOX1 enzymatic activity, which might reduce tumor cell invasion and metastasis .

  • Targeting QSOX1-dependent pathways, such as those involving matrix metalloproteinases, which are affected by QSOX1 activity .

  • Exploiting the relationship between matrix stiffness and QSOX1 expression to develop combination therapies that target both the mechanical properties of the tumor microenvironment and QSOX1 function .

Any therapeutic approaches would need to carefully consider the context-dependent nature of QSOX1 function and potential off-target effects, given QSOX1's role in normal physiological processes .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.