Recombinant Chicken Suppressor of tumorigenicity 7 protein homolog (ST7)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, should you have a specific format preference, please indicate it in your order remarks. We will then prepare according to your requirements.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate this in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein with deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50% and can serve as a reference point for your use.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during the production process. If you have a specific tag type in mind, please let us know, and we will prioritize developing the specified tag.
Synonyms
ST7; Suppressor of tumorigenicity 7 protein homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-554
Protein Length
Full length protein
Species
Gallus gallus (Chicken)
Target Names
ST7
Target Protein Sequence
MAEAGTGFLEQLKSCIVWSWTYLWTLWFFIMLFLVYILRVPLKINDNLTTVSMFLNTLTP KFYVALTGTSSLISGLILIFEWWYFRKYGTSFIEQVSVSHLRPLLGGVDNSAPSAANAAN GEADSSRQSVSECKVWRNPLNLFRGAEYNRYTWVTGREPLTYYDMNLSAQDHQTFFTCDT DHLRPADAIMQKAWRERNPQARISAAHEALELNECATAYILLAEEEATTIVEAEKLFKQA LKAGEGCYRRSQQLQHHGAQYEAQHRRDTNVLVYIKRRLAMCARKLGRTREAVKMMRDLM KEFPLLSMFNIHENLLEALLELQAYADVQAVLAKYDDISLPKSATICYTAALLKARAVSD KFSPEAASRRGLSTAEMNAVEAIHRAVEFNPHVPKYLLEMKSLILPPEHILKRGDSEAIA YAFFHLQHWKRVEGALNLLHCTWEGTFRMIPYPLEKGHLFYPYPICTETADRELLPSFHE VSVYPKKELPFFILFTAGLCSFTAMLALLTHQFPELMGVFAKAFLSTLFAPLNFVMEKVE SILPSSLWHQLTRI
Uniprot No.

Target Background

Database Links

KEGG: gga:417770

UniGene: Gga.6519

Protein Families
ST7 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Suppressor of Tumorigenicity 7 (ST7) and what is its biological significance?

ST7 has been identified as a tumor suppressor gene located in chromosome region 7q31.1-q31.2. The protein plays a critical role in regulating cellular mechanisms that prevent malignant transformation. Based on research with human cancer cell lines, ST7 functions primarily through regulation of genes involved in maintaining cellular structure and those within oncogenic pathways . In chicken models, the protein maintains similar tumor suppressive properties while serving as an excellent research model due to the chicken's evolutionary position and genomic characteristics.

What expression patterns does ST7 demonstrate across normal and cancer tissues?

ST7 exhibits tissue-specific expression patterns that vary between normal and cancerous states. Cell cycle synchronization studies have demonstrated that both ST7 and SERPINE1 are overexpressed when cells are in an arrested state, with expression diminishing when cells re-enter division phases . This pattern suggests that ST7 functions as a checkpoint regulator in cell proliferation, potentially acting as a brake on excessive cellular division. Furthermore, the diversity in transgene integration patterns in transgenic chicken models results in varying levels of expression of exogenous genes across different tissues .

What are the standard methods for producing recombinant Chicken ST7?

Recombinant Chicken ST7 protein can be produced through several methodologies:

Mammalian Cell Expression Systems:

  • Recombinant Chicken ST7L is commonly expressed in mammalian cell systems to ensure proper folding and post-translational modifications .

  • His-tagged versions can be produced with >80% purity using appropriate expression vectors .

Transgenic Chicken Models:

  • Site-specific recombination technologies, particularly recombinase-mediated gene cassette exchange (RMCE), have been successfully employed in chicken genomes .

  • The establishment of transgenic chicken lines containing Flipase (Flp) recognition target (FRT) pairs, mediated by piggyBac transposition, provides a platform for stable expression .

How can site-specific recombination improve recombinant ST7 expression?

Site-specific recombination technologies offer significant advantages for controlled expression of recombinant ST7 in chicken models. The successful implementation of recombinase-mediated gene cassette exchange (RMCE) in transgenic chickens has demonstrated that:

  • Integration of FRT pairs in the chicken genome allows for precise targeting of transgene insertion .

  • The diverse integration patterns observed in different transgenic chicken lines result in varying expression levels across tissues, allowing researchers to select optimal expression profiles for specific research objectives .

  • Replaced gene cassettes maintain stable expression when introduced through RMCE at FRT-flanked loci .

This approach enables researchers to achieve customized expression of functional ST7 protein at predicted levels without unwanted epigenetic influences, which is crucial for studying dose-dependent effects and tissue-specific functions .

What are the challenges in establishing stable ST7 expression systems?

Several challenges exist when establishing stable expression systems for recombinant Chicken ST7:

Transgene Integration Variability:

  • Integration patterns of the ST7 transgene can vary significantly between different transgenic chicken lines .

  • This variability leads to diverse expression levels of exogenous genes across tissues .

Epigenetic Influences:

  • Traditional random integration methods are susceptible to epigenetic silencing over time.

  • RMCE approaches help mitigate these effects, allowing for more predictable expression without epigenetic influence .

Production Complexity:

  • Custom production of high-quality recombinant ST7 protein requires specialized techniques and typically involves a 5-9 week lead time .

  • Maintaining proper protein conformation and functional activity presents technical challenges during purification processes.

How does ST7 function as a tumor suppressor at the molecular level?

ST7's tumor suppressor function operates through distinct molecular mechanisms:

Cell Cycle Regulation:

  • ST7 and SERPINE1 show coordinated overexpression during cell cycle arrest .

  • Their expression diminishes when cells re-enter division phases, suggesting a role in cell cycle checkpoint regulation .

Gene Regulation Network:

  • ST7 appears to mediate tumor suppression by regulating genes involved in:

    • Maintaining cellular structure

    • Modulating oncogenic pathways

Related Gene Interactions:

  • Studies have identified differential expression of Survivin, MMP-13, and Cyclin D1 during the cell cycle in association with ST7 activity .

  • These interactions suggest ST7 functions within a broader regulatory network controlling cell proliferation and survival.

What expression systems are optimal for functional studies of recombinant ST7?

When designing expression systems for functional studies of recombinant ST7, researchers should consider:

Mammalian Expression Systems:

  • The recombinant Chicken ST7L has been successfully expressed in mammalian cells with His-tags for purification .

  • This system allows for proper protein folding and post-translational modifications.

Transgenic Chicken Models:

  • For in vivo studies, transgenic chicken lines carrying site-specific recombination sites offer significant advantages .

  • PiggyBac transposition-mediated integration of FRT pairs enables stable transgene expression .

Expression Vector Design:

  • For localization studies, fusion proteins with fluorescent tags (GFP, YFP) or epitope tags (V5) have been successfully employed .

  • Gateway cloning systems have proven effective for constructing various ST7 expression vectors .

Expression SystemAdvantagesLimitationsApplications
Mammalian cellsProper folding, PTMsHigher costProtein production, functional assays
Bacterial systemsHigh yield, low costLimited PTMsStructural studies, antibody production
Transgenic chickensIn vivo expression, physiological contextTime-consuming, complexDevelopmental studies, tissue-specific effects
Cell-free systemsRapid expressionLimited modificationsPreliminary studies, protein interaction assays

What purification strategies yield the highest quality recombinant ST7 protein?

For optimal purification of recombinant Chicken ST7:

Affinity Chromatography:

  • His-tagged versions can be purified using nickel or cobalt affinity resins .

  • Protein purity of >80% can be achieved with optimized conditions .

Buffer Conditions:

  • Storage in PBS buffer maintains protein stability .

  • For long-term storage, temperatures between -20°C and -80°C are recommended .

Quality Control Metrics:

  • Endotoxin levels should be maintained below 1.0 EU per μg of protein as determined by LAL method .

  • Functional assays should verify that the purified protein retains its native biological activity.

How can cellular localization of ST7 be determined experimentally?

Based on research methodologies, ST7 localization can be effectively studied through:

Fluorescent Fusion Proteins:

  • GFP and YFP-tagged ST7 constructs have been successfully used to visualize ST7 localization in cancer cell lines .

  • These studies have identified primarily cytosolic expression of ST7 in HCT-116, MCF-7, and PC-3 cancer cell lines .

Epitope Tagging:

  • V5-tagged ST7 constructs provide an alternative approach for localization studies using immunofluorescence .

  • Gateway cloning systems facilitate the generation of these tagged constructs .

Subcellular Fractionation:

  • Biochemical separation of cellular compartments followed by western blotting can confirm localization findings.

  • Interestingly, translocation of ST7 from cytoplasm to nucleus has not been observed under various experimental conditions .

What cell models are appropriate for studying ST7 function?

Several cell models have proven effective for ST7 research:

Cancer Cell Lines:

  • HCT-116 (colorectal cancer), MCF-7 (breast cancer), and PC-3 (prostate cancer) lines have been successfully used to study ST7 expression and localization .

  • These models allow for investigation of ST7's tumor suppressor function in different cancer types.

Chicken Cell Models:

  • Primary chicken cells derived from transgenic chickens carrying ST7 constructs provide valuable insights into tissue-specific effects .

  • Cells derived from transgenic chickens with FRT sites allow for RMCE-based modification of ST7 expression .

Cell Cycle Synchronization:

  • Synchronized cell populations enable the study of ST7 expression dynamics throughout the cell cycle .

  • This approach has revealed the relationship between cell cycle arrest and ST7 overexpression .

How can gene editing technologies optimize ST7 functional studies?

Modern gene editing approaches offer powerful tools for ST7 research:

Site-Specific Recombination:

  • RMCE technology using Flipase (Flp) and FRT sites enables precise manipulation of ST7 expression in the chicken genome .

  • This approach allows for:

    • Specific gene regulation through cis-element insertion

    • Customized expression of functional proteins at predictable levels

    • Elimination of epigenetic influences on transgene expression

Transgenic Chicken Development:

  • PiggyBac transposition has been successfully employed to establish transgenic chicken lines carrying FRT sites for subsequent manipulation .

  • These models demonstrate diverse transgene integration patterns, allowing selection of optimal expression profiles .

What bioinformatic approaches can elucidate ST7 protein interactions?

To understand ST7's interaction network:

Protein-Protein Interaction Prediction:

  • Computational analysis of potential binding partners based on sequence and structural features.

  • Integration with experimental data from co-immunoprecipitation or yeast two-hybrid studies.

Pathway Analysis:

  • Identification of pathways influenced by ST7 expression, particularly those involved in cell structure maintenance and oncogenic signaling .

  • Correlation of ST7 expression with levels of related proteins like SERPINE1, Survivin, MMP-13, and Cyclin D1 .

Comparative Genomics:

  • Analysis of ST7 conservation across species to identify functionally important domains.

  • Chicken ST7 comparison with human and other vertebrate homologs provides evolutionary context.

How can low expression levels of recombinant ST7 be improved?

When facing low ST7 expression:

Optimization Strategies:

  • Selection of high-expression FRT loci in transgenic chicken models .

  • Codon optimization of the ST7 sequence for the expression system.

  • Use of strong promoters suitable for the target cell type.

Expression Conditions:

  • Adjustment of induction parameters (timing, temperature, inducer concentration).

  • Optimization of cell culture conditions to promote protein stability.

Fusion Partners:

  • Addition of solubility-enhancing tags or fusion partners.

  • Selection of appropriate purification tags based on expression system .

What strategies address protein degradation during ST7 purification?

To minimize degradation:

Stabilization Approaches:

  • Addition of protease inhibitors throughout purification.

  • Optimization of buffer conditions to maintain protein stability.

  • Performance of purification steps at reduced temperatures.

Storage Considerations:

  • For short-term storage, maintain at +4°C .

  • For long-term storage, store at -20°C to -80°C in PBS buffer .

  • Addition of stabilizing agents like glycerol or specific salt concentrations.

How might recombinant ST7 research contribute to cancer therapeutics?

Potential therapeutic applications include:

Target Validation:

  • Detailed understanding of ST7's tumor suppressor mechanism could identify novel therapeutic targets.

  • The relationship between ST7 and genes like SERPINE1, Survivin, MMP-13, and Cyclin D1 suggests multiple intervention points .

Biomarker Development:

  • Correlation of ST7 expression patterns with disease progression may yield valuable prognostic markers.

  • Cell cycle-related expression patterns could inform treatment timing and efficacy .

Chicken Models for Drug Testing:

  • Transgenic chicken models with modified ST7 expression offer unique platforms for evaluating cancer therapeutics .

  • The ability to achieve predictable expression levels without epigenetic influence provides advantages for therapeutic testing .

What emerging technologies might enhance ST7 research?

Several cutting-edge approaches show promise:

Single-Cell Analysis:

  • Investigation of ST7 expression heterogeneity within tissues and tumors.

  • Correlation of expression levels with cell states and phenotypes.

Advanced Imaging Techniques:

  • Super-resolution microscopy for detailed subcellular localization studies.

  • Live-cell imaging of fluorescently tagged ST7 to track dynamic behaviors.

Structural Biology Approaches:

  • Cryo-EM or X-ray crystallography of ST7 complexes to understand molecular interactions.

  • Structural information could guide rational design of modulators for research or therapeutic purposes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.