Recombinant Chicken Suppressor of tumorigenicity 7 protein-like (ST7L)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and arranged in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
ST7L; HELG; Suppressor of tumorigenicity 7 protein-like; Protein HELG
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-555
Protein Length
full length protein
Species
Gallus gallus (Chicken)
Target Names
ST7L
Target Protein Sequence
MADGCGTGKEPPYPGAAAALRRWEQLRRRAAAPWARGLLAVAAGLGLFYAALRVPLRLRD GLAAVTVFLSTLTPKFYFALTVTSSFISGLIFVFEWWHFRKYGTSFIEQVSVSHLRPLIG GVENSPPAPAAFSAGENEANRQNMPECKMWRNPLNLFRGAEYSRYMWVTGKEPLTYYDMN LSAQDHQNFFTCDTDALRPSDTVMQKAWRERNPQARIKAAYQALELNNDCATAYVLLAEE EATTIVDAERYFKQALKAGEMIYRKSQNCHSQSPQHEAQLRRDTNVLVYVKRRLAMCARK LGRIRESVKMMRDLMKEFPLLSMLNIHENLLEALLELQAYADVQAVLAKYDDISLPKSAA ICYTAALLKARAVSERFSPETAFKRGLSTAEINAVEAIHRAVEFNPHVPKYLLEMKSLVL PPEHILKRGDSEAVAYAFFHLQHWKRIEGALHLLHCTWEGTFRMIPYPLEKGHLFYPYPS CTETADRELLPTFHEVSVYPQKELPFFIHFTAGLCSFSAMLALLTHQFPELMVVFAKAVL RVLWPVSAPSVLASG
Uniprot No.

Target Background

Database Links

KEGG: gga:395331

UniGene: Gga.4635

Protein Families
ST7 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is ST7L and how does it relate to the ST7 tumor suppressor gene?

ST7L (ST7-like, also known as ST7R) is a protein that shares significant homology with the ST7 tumor suppressor gene. Based on human ST7L studies, the protein demonstrates approximately 72.1% total-amino-acid identity with human ST7 and features conserved domains that suggest similar but potentially distinct biological functions . The chicken ST7L would be expected to maintain key functional domains while exhibiting species-specific variations. Methodologically, researchers should approach chicken ST7L characterization through comparative sequence analysis against mammalian orthologs, focusing on the conservation of key structural elements including the leucine zipper domain and tyrosine phosphorylation sites that are present in human ST7L .

What are the key structural domains of chicken ST7L protein?

Based on homology with human ST7L, chicken ST7L protein likely contains several key structural domains including:

  • A leucine zipper domain, which is unique to ST7L compared to ST7

  • Multiple tyrosine phosphorylation sites (particularly sites homologous to Tyr268 and Tyr441 in human ST7L)

  • Three ST7L-homologous domains (S7H1, S7H2, and S7H3) that are evolutionarily conserved

When designing experiments involving chicken ST7L, researchers should consider these domains for site-directed mutagenesis studies to assess functional significance. Additionally, when expressing recombinant fragments, ensure preservation of these domains for maintaining native functionality.

What expression systems are most effective for recombinant chicken ST7L production?

For recombinant chicken ST7L production, several expression systems can be utilized with varying advantages:

Expression SystemAdvantagesLimitationsRecommended Applications
E. coliHigh yield, cost-effective, rapid expressionLimited post-translational modificationsStructural studies, antibody production
Mammalian cells (HEK293)Native-like post-translational modificationsLower yield, higher costFunctional studies, protein-protein interactions
Insect cellsIntermediate between bacterial and mammalian systemsMedium complexityLarge-scale production of properly folded protein

Methodologically, researchers should optimize codon usage for the chicken sequence and consider using fusion tags (His, Fc, or Avi tags) to facilitate purification while minimizing interference with protein function . For functional studies requiring proper folding and post-translational modifications, mammalian expression systems typically yield more biologically relevant results.

How can researchers effectively purify recombinant chicken ST7L while maintaining its functional integrity?

Purification of recombinant chicken ST7L requires careful consideration of protein characteristics to maintain functional integrity. A comprehensive purification protocol should include:

  • Initial clarification of cell lysate through centrifugation (10,000g, 30 minutes, 4°C)

  • Affinity chromatography using an appropriate tag (His-tag affinity on Ni-NTA columns proves effective for many researchers)

  • Size exclusion chromatography to separate monomeric protein from aggregates

  • Assessment of protein purity through SDS-PAGE and Western blotting

Critical considerations include: maintaining reducing conditions throughout purification to prevent non-native disulfide formation; using protease inhibitors to prevent degradation; and performing quality control through circular dichroism to confirm proper folding. For functional studies, researchers should confirm activity through targeted assays immediately after purification as ST7L may lose activity during storage, particularly after freeze-thaw cycles.

What techniques are most suitable for investigating the interaction between chicken ST7L and WNT signaling pathways?

Given the genomic clustering of ST7R/ST7L with WNT2B genes in humans , investigating potential interactions between chicken ST7L and WNT signaling pathways represents a critical research area. Methodological approaches should include:

  • Co-immunoprecipitation assays using tagged recombinant chicken ST7L to identify potential binding partners within the WNT pathway

  • TCF/LEF luciferase reporter assays to assess the impact of ST7L overexpression or knockdown on WNT signaling activation

  • Chromatin immunoprecipitation (ChIP) to determine if ST7L directly or indirectly influences WNT target gene expression

  • Proximity ligation assays (PLA) to visualize protein-protein interactions in situ

These approaches should be conducted in appropriate cellular contexts, such as chicken cell lines where endogenous WNT signaling is active. The interpretation of results should consider that ST7L may function as either a positive or negative regulator of WNT signaling, potentially in a context-dependent manner.

How do post-translational modifications affect chicken ST7L function and how can they be characterized?

Post-translational modifications (PTMs) likely play crucial roles in regulating chicken ST7L function. Based on human ST7L data, tyrosine phosphorylation sites are particularly significant . A comprehensive characterization approach includes:

  • Mass spectrometry analysis of recombinant chicken ST7L expressed in mammalian cells to identify PTM sites

  • Site-directed mutagenesis of predicted PTM sites followed by functional assays

  • Phospho-specific antibodies to monitor phosphorylation status in various cellular conditions

  • Inhibitor studies using kinase or phosphatase inhibitors to determine regulatory enzymes

Researchers should pay particular attention to sites homologous to human ST7L Tyr268 and Tyr441, which are conserved across species . Additionally, investigating potential crosstalk between different PTMs provides insights into the complex regulation of ST7L function in chickens compared to mammals.

What are the most reliable knockdown/knockout strategies for studying chicken ST7L function in avian cell models?

For effective functional analysis of chicken ST7L, researchers can employ several gene manipulation strategies:

MethodAdvantagesLimitationsBest Applications
CRISPR-Cas9 knockoutComplete protein eliminationPotential lethality if essentialDetermining essential functions
siRNA/shRNA knockdownTemporary, titratable reductionIncomplete silencingStudying dose-dependent effects
Dominant negative mutantsCan target specific domainsMay have off-target effectsDomain-specific function studies
Inducible expression systemsTemporal controlSystem leakinessDevelopmental studies

When designing CRISPR-Cas9 targeting strategies, researchers should target early exons while avoiding regions with homology to other genes, particularly ST7. For knockdown approaches, at least three independent siRNA sequences should be validated to confirm specificity. For studying chicken ST7L in development contexts, consider the Tet-on/off systems with chicken-optimized components.

How can researchers effectively analyze the impact of ST7L on transcriptional networks in chicken cells?

Given the potential role of ST7L in cancer suppression pathways, characterizing its impact on transcriptional networks is crucial. A comprehensive analytical approach includes:

  • RNA-Seq analysis comparing control versus ST7L-overexpressing or ST7L-knockdown chicken cell lines

  • ChIP-Seq to identify genomic regions associated with ST7L, potentially through interacting transcription factors

  • ATAC-Seq to determine chromatin accessibility changes influenced by ST7L activity

  • Integration of multi-omics data through pathway enrichment analysis

For data interpretation, researchers should analyze differential gene expression patterns using tools like DESeq2 with appropriate statistical thresholds (adjusted p-value < 0.05, |log2 FC| > 1.5) . Particular attention should be paid to genes involved in cell cycle regulation, DNA repair pathways, and immune response, as these have been implicated in ST7-related functions in mammalian systems .

What are the most informative assays to determine if chicken ST7L functions as a tumor suppressor?

To evaluate the potential tumor suppressor function of chicken ST7L, researchers should employ multiple complementary approaches:

  • Colony formation assays in soft agar following ST7L overexpression or knockdown

  • Cell cycle analysis using flow cytometry with propidium iodide staining

  • Apoptosis assays (Annexin V/PI staining) under various stress conditions

  • In vivo tumor formation studies using chicken embryo models with manipulated ST7L expression

  • Migration and invasion assays to assess metastatic potential

Results should be analyzed in the context of known tumor suppressor mechanisms, particularly focusing on:

  • Cell cycle checkpoint regulation (G1/S and G2/M transitions)

  • DNA damage response pathways

  • Regulation of apoptotic thresholds

  • Effects on epithelial-to-mesenchymal transition markers

Statistical analysis should include appropriate controls and multiple biological replicates (minimum n=3) with blinded assessment of phenotypic outcomes.

How does chicken ST7L compare structurally and functionally to mammalian orthologs?

Comparative analysis between chicken ST7L and mammalian orthologs provides valuable insights into evolutionary conservation and species-specific adaptations:

FeatureHuman ST7LChicken ST7L (Predicted)Implications for Research
Leucine zipper domainPresentLikely presentPotential for conserved protein interactions
Tyrosine phosphorylation sites3 sites (Tyr268, Tyr441 conserved)Expected conservation of key sitesSimilar regulatory mechanisms
S7H1, S7H2, S7H3 domainsConservedLikely conservedFunctionally significant regions
Alternative splicing4 isoformsRequires investigationPotential for tissue-specific functions

When designing comparative studies, researchers should perform detailed sequence alignments and structural predictions, followed by functional assays in both avian and mammalian cell systems. Cross-species complementation experiments, where chicken ST7L is expressed in mammalian ST7L-knockout cells, can reveal the degree of functional conservation.

What techniques are most appropriate for investigating the tissue-specific expression patterns of ST7L in chicken tissues?

Understanding tissue-specific expression patterns is essential for characterizing physiological roles of chicken ST7L. Methodological approaches include:

  • Quantitative RT-PCR across multiple chicken tissues with isoform-specific primers

  • RNA-Seq analysis of various chicken tissues at different developmental stages

  • In situ hybridization to localize mRNA expression in tissue sections

  • Immunohistochemistry using validated ST7L antibodies to detect protein localization

For comprehensive analysis, researchers should:

  • Compare expression patterns with the WNT2B gene, given their genomic clustering in mammals

  • Analyze correlation with tissue-specific tumorigenesis susceptibility

  • Investigate developmental regulation through embryonic stage analysis

  • Consider the presence of alternative splice variants that may have tissue-specific functions

Data analysis should include normalization to appropriate housekeeping genes and statistical comparison across tissues to identify significant expression differences.

How can recombinant chicken ST7L be utilized to study potential tumor suppressor mechanisms in avian cancer models?

Recombinant chicken ST7L provides a valuable tool for investigating tumor suppression mechanisms in avian cancer models. Research approaches include:

  • Developing stable chicken cell lines with inducible ST7L expression

  • Creating ST7L fusion proteins with reporter tags for real-time visualization

  • Utilizing recombinant ST7L in protein-protein interaction screens to identify binding partners

  • Engineering chicken ST7L variants based on tumor-associated mutations found in mammalian orthologs

For avian tumor models, researchers can employ:

  • Chicken embryo chorioallantoic membrane (CAM) assays for tumor growth studies

  • Genetic modification of chicken lymphoma cell lines

  • Ex vivo organ culture systems with ST7L modulation

  • Comparative oncology approaches examining ST7L function across species

Analysis should focus on identifying conserved tumor suppressor mechanisms while noting avian-specific pathways that may inform broader understanding of ST7L biology.

What is known about the potential role of chicken ST7L in WNT signaling pathway regulation compared to human ST7L?

Given the genomic clustering of ST7-WNT2 and ST7L-WNT2B in humans , investigating chicken ST7L's role in WNT signaling regulation is particularly relevant:

  • Based on human data, ST7L may function in regulating the WNT-β-catenin-TCF signaling pathway

  • Research should compare chicken ST7L's effects on canonical versus non-canonical WNT signaling pathways

  • Analysis should include assessment of β-catenin stabilization, nuclear translocation, and target gene activation

  • Potential cross-talk with other signaling pathways (Notch, Hedgehog) should be investigated

Methodologically, researchers should:

  • Perform TOPFlash/FOPFlash luciferase reporter assays in chicken cells with modulated ST7L expression

  • Analyze β-catenin localization through subcellular fractionation and immunofluorescence

  • Examine ST7L/WNT2B expression correlation in chicken tissues and cell lines

  • Investigate potential direct interaction between ST7L and WNT pathway components

Such comparative studies may reveal evolutionary conservation or divergence in ST7L function across species.

What emerging technologies could advance our understanding of chicken ST7L structure-function relationships?

Emerging technologies offering new insights into chicken ST7L include:

  • AlphaFold2 and other AI-based protein structure prediction methods to model chicken ST7L structure without crystallographic data

  • Single-cell RNA-Seq to delineate cell-type specific expression patterns in heterogeneous tissues

  • CRISPR-based epigenome editing to investigate regulation of ST7L expression

  • Proximity-dependent biotin labeling (BioID or TurboID) to identify the ST7L interactome in chicken cells

  • Cryo-electron microscopy for visualizing ST7L-containing protein complexes

These approaches would significantly enhance understanding of:

  • Protein domain functions through accurate structural models

  • Cellular contexts where ST7L is most active

  • Regulatory mechanisms controlling ST7L expression

  • Protein interaction networks involving ST7L

  • Macromolecular complex formation relevant to ST7L function

Researchers should consider combining these cutting-edge approaches with traditional biochemical methods for comprehensive characterization.

How might comparative studies between chicken and human ST7L inform cancer research and potential therapeutic strategies?

Comparative studies between chicken and human ST7L can yield valuable insights for cancer research through:

  • Identification of evolutionarily conserved functional domains that represent essential regions for tumor suppressor activity

  • Discovery of species-specific regulatory mechanisms that may reveal novel therapeutic targets

  • Understanding of context-dependent functions across different tissue types and developmental stages

  • Elucidation of differential responses to oncogenic signals between species

For translational applications, researchers should:

  • Develop screening assays using chicken ST7L to identify compounds that modulate its activity

  • Create chimeric ST7L proteins (human-chicken) to pinpoint functionally critical regions

  • Investigate synthetic lethality approaches targeting cells with ST7L mutations or deletions

  • Explore ST7L as a biomarker for cancer prognosis, building on findings that ST7L-related genes may have prognostic value

The comparative approach offers unique perspectives that single-species studies cannot provide, potentially revealing fundamental mechanisms of tumor suppression.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.