Recombinant Chicken Surfeit locus protein 1 (SURF1)

What is the structure and function of chicken SURF1 protein?

Chicken Surfeit locus protein 1 (SURF1) contains 309 amino acids and functions as an assembly factor for cytochrome c oxidase (COX), essential for maintaining the stability of complex IV in the electron respiratory chain. The protein features two transmembrane domains—one at the N-terminus and the other at the C-terminus—which are essential for its function . The amino acid sequence (MATWGLLLRAGPRLLRERRARISHCLLRRTFFGFPRTKAGSAVTQQGDVCLRLCSPRSST TATSAAGEDAWLKWGLLLVPLTAFCLGTWQIQRRKWKLDLIAQLASRLSSEPIPLTLDPM ELKELEYRPVKVRGHFDHSKELYILPRSLVDPEREAREAGKLTSHAENGANVITPFYCTE LGVTILVNRGFVPKKKLKPETRLKGQIEEEIDLTGVVRLSEKRKPFVPENNIEKNRWHYR DLEAMAKVTGAEPIFIDADFRSTVPGGPIGGQTRVSLRNEHMQYIVTWYGLCAATSFLWY RKFIQKIPL) is highly conserved across species, demonstrating its evolutionary importance .

How is recombinant chicken SURF1 typically produced for research purposes?

Recombinant chicken SURF1 is most commonly expressed in E. coli expression systems, where the full-length protein (1-309aa) is produced with an N-terminal His tag for purification purposes . The production typically involves:

• Cloning the chicken SURF1 gene (optimized for expression) into a suitable expression vector

• Transforming the construct into E. coli

• Inducing protein expression under controlled conditions

• Purifying using affinity chromatography (exploiting the His tag)

• Processing the protein into a final form, often as a lyophilized powder in Tris/PBS-based buffer with 6% Trehalose (pH 8.0)

For optimal results, it's recommended to reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL and add 5-50% glycerol for long-term storage at -20°C/-80°C .

What experimental applications is recombinant chicken SURF1 commonly used for?

Recombinant chicken SURF1 is primarily used in:

• SDS-PAGE and Western blot analysis for antibody validation and protein interaction studies

• Structural biology investigations comparing SURF1 across species

• Development of antibodies against conserved SURF1 epitopes

• Functional studies examining COX assembly mechanisms

• Comparative biochemistry between avian and mammalian mitochondrial systems

When using recombinant chicken SURF1 in experimental workflows, it's important to note that repeated freeze-thaw cycles should be avoided, and working aliquots should be stored at 4°C for no more than one week to maintain protein integrity and activity .

How do chicken and human SURF1 proteins compare in structure and function, and what implications does this have for cross-species research models?

The genomic structure of SURF1 is remarkably well-conserved from chicken to human, with significant homology in the functional domains . Sequence analysis reveals:

What methodological approaches are most effective for studying SURF1 function in mitochondrial models, and how does recombinant chicken SURF1 contribute to these studies?

Multiple complementary approaches have proven effective for studying SURF1 function:

• Genetic knockout models: SURF1-deficient mouse models have shown decreased COX activity (40-50% remaining vs. 20-30% in human patients), helping elucidate compensatory mechanisms like mitochondrial biogenesis and UPR^MT activation .

• Gene replacement studies: AAV9-based gene therapy with SURF1 has demonstrated partial restoration of COX activity in animal models, with improvement in the range of 20-30% over knockout levels .

• Cell-based assays: Utilizing recombinant SURF1 proteins for cell-based functional reconstitution studies.

• Comparative approaches: Using recombinant chicken SURF1 alongside recombinant human SURF1 for direct comparative studies.

Recombinant chicken SURF1 contributes significantly by enabling:

• Structure-function analysis through site-directed mutagenesis

• Protein-protein interaction studies with other components of the COX assembly machinery

• Development of species-cross-reactive tools for studying SURF1 biology

For optimal results, researchers should implement multiple methodologies, as each provides complementary insights into SURF1 function in mitochondrial biology .

What are the key experimental design considerations when using recombinant chicken SURF1 to study mitochondrial disorders?

When designing experiments with recombinant chicken SURF1, researchers should consider:

• Appropriate controls: Include both positive controls (wild-type SURF1) and negative controls (inactive SURF1 mutants or buffer-only conditions) .

• Physiological relevance: Despite in vitro simplicity, correlate findings with in vivo models. Research has shown discrepancies between in vitro isolated mitochondria studies and in vivo physiological measures in SURF1-deficient models .

• Expression systems compatibility: Ensure the expression system (often E. coli-derived) does not introduce artifacts that might impact functional studies .

• Impact of tags: Consider how the His-tag might affect protein function or interaction. When possible, compare tagged vs. untagged proteins or use cleavable tags .

• Buffer composition effects: Optimize buffer conditions as they significantly impact SURF1 stability and function. The recommended storage buffer includes Tris/PBS with 6% Trehalose at pH 8.0 .

• Temperature sensitivity: SURF1 proteins show temperature-dependent stability profiles that may affect experimental outcomes. For chicken SURF1 specifically, experiments at physiological avian body temperature (40-42°C) versus mammalian temperature (37°C) may yield different results .

How can researchers reconcile contradictory data between in vitro and in vivo studies of SURF1 function?

One of the most challenging aspects of SURF1 research is reconciling contradictions between in vitro and in vivo findings:

• Tissue-specific compensation mechanisms: SURF1-deficient mouse models show tissue-specific compensatory responses. In heart tissue, there's increased glucose uptake (33% higher) and mitochondrial biogenesis that may mask defects seen in isolated mitochondria .

• Exercise vs. basal activity discrepancies: While SURF1-deficient mice show normal basal activity, they display significantly decreased endurance capacity and elevated blood lactate levels under exercise conditions, suggesting that physiological stress unveils defects not apparent in resting conditions .

• Methodological resolution limits: In vitro assays may not detect subtle functional changes that become physiologically relevant in vivo.

To reconcile these contradictions, researchers should:

• Implement stress tests in cellular and animal models to reveal phenotypes not apparent under basal conditions

• Utilize multiple assays to measure the same parameter

• Consider tissue-specific effects and compensation mechanisms

• Integrate findings across multiple experimental scales (molecular, cellular, tissue, and organismal)

What recent advances in SURF1 research models have implications for researchers working with recombinant chicken SURF1?

Recent advances in SURF1 research models include:

• Zebrafish models: Researchers at Children's Hospital of Philadelphia developed zebrafish models using CRISPR technology that accurately represent clinical issues encountered in patients with SURF1 deficiency. These models identified two FDA-approved drugs that could potentially be repurposed to treat SURF1-related Leigh syndrome .

• AAV9-based gene therapy: Research demonstrates that AAV9 vectors expressing SURF1 can partially restore COX activity in SURF1-deficient models, with improvements in the brain and muscle tissue. This suggests therapeutic potential for recombinant SURF1 delivery .

• Multi-tissue analysis of SURF1 deficiency effects: Studies have revealed that SURF1 deficiency triggers distinct compensatory mechanisms in different tissues:

  • Heart: Increased glucose uptake and activation of the Nrf2 antioxidant response

  • Skeletal muscle: Upregulation of the mitochondrial unfolded protein response (UPR^MT)

  • Both tissues: Increased mitochondrial biogenesis markers (PGC-1α and VDAC)

These advances suggest that recombinant chicken SURF1 could serve as a valuable comparative tool for understanding species-specific aspects of SURF1 function and for developing cross-species therapeutics for mitochondrial disorders .

What are the optimal storage and handling conditions for maintaining the stability and activity of recombinant chicken SURF1?

Based on empirical research data, the following conditions are optimal for maintaining recombinant chicken SURF1 stability:

• Storage form: Lyophilized powder for long-term storage; reconstituted with glycerol for working solutions

• Storage temperature: -20°C/-80°C for long-term storage; 4°C for working aliquots (not exceeding one week)

• Reconstitution buffer: Deionized sterile water to a concentration of 0.1-1.0 mg/mL

• Stabilizing additives: 5-50% glycerol final concentration (50% is typically recommended)

• pH conditions: Optimal stability at pH 8.0

• Buffer composition: Tris/PBS-based buffer with 6% Trehalose

• Freeze-thaw cycles: Minimize, as repeated cycles significantly reduce activity

Research has demonstrated that properly stored recombinant chicken SURF1 maintains >90% of its original purity and function for at least 12 months when these conditions are strictly observed .

What methodological approaches best overcome the challenges of assessing chicken SURF1 function in heterologous systems?

Researchers face several challenges when assessing chicken SURF1 function in heterologous systems. Effective methodological approaches include:

• Complementation assays: Using SURF1-deficient mammalian cell lines complemented with chicken SURF1 to assess functional rescue. Key metrics include:

  • COX activity restoration (% of wild-type activity)

  • Mitochondrial membrane potential normalization

  • ATP production recovery

• Chimeric protein analysis: Creating chicken-mammalian SURF1 chimeras to identify functionally interchangeable domains.

• Subcellular localization verification: Confirming proper mitochondrial targeting of chicken SURF1 in mammalian cells through:

  • Immunofluorescence microscopy

  • Subcellular fractionation

  • Protease protection assays

• Species-specific interaction mapping: Using techniques like proximity labeling or co-immunoprecipitation to compare chicken SURF1 interaction partners with those of mammalian SURF1.

• Oxygen consumption analysis: Measuring respiratory function through high-resolution respirometry to assess the impact of chicken SURF1 expression on mitochondrial respiration in deficient systems .

These approaches collectively provide robust assessment of chicken SURF1 function across heterologous systems while accounting for species-specific differences in mitochondrial biology.

How can researchers best design experimental controls when studying recombinant chicken SURF1 in comparison to mammalian models?

Proper experimental controls are critical when comparing recombinant chicken SURF1 to mammalian models:

• Positive controls:

  • Wild-type mammalian SURF1 (species-matched to the experimental system)

  • Validated functional recombinant human SURF1

  • Native chicken SURF1 (when available)

• Negative controls:

  • Buffer-only conditions

  • Functionally inactive SURF1 mutants (e.g., pathogenic mutations known to cause Leigh syndrome)

  • Irrelevant recombinant proteins expressed and purified under identical conditions

• Specificity controls:

  • Other members of the surfeit gene family to demonstrate SURF1-specific effects

  • Other mitochondrial assembly factors to distinguish general from SURF1-specific effects

• Expression level controls:

  • Dose-response studies to account for potential overexpression artifacts

  • Time-course analyses to capture dynamic effects

• Species-specific controls:

  • When studying chicken SURF1 in mammalian systems, include Xenopus SURF1 as an additional non-mammalian control

  • When available, include recombinant SURF1 from evolutionarily intermediate species to establish functional conservation patterns

Implementation of this comprehensive control strategy ensures robust, reproducible findings when comparing chicken SURF1 to mammalian models in experimental systems .

How might insights from chicken SURF1 research contribute to therapeutic approaches for human SURF1-related disorders?

The evolutionary conservation of SURF1 between chicken and human makes chicken SURF1 research valuable for therapeutic development:

• Structure-function insights: The conserved functional domains between chicken and human SURF1 provide templates for designing targeted therapies that enhance COX assembly .

• Gene therapy optimization: Studies in mice using AAV9-based SURF1 gene therapy demonstrated 20-30% improvement in COX activity over knockout levels. Comparative studies with chicken SURF1 could identify beneficial functional variations that might enhance therapeutic efficacy .

• Compensatory pathway discovery: Research in SURF1-deficient models revealed compensatory mechanisms including:

  • Increased mitochondrial biogenesis (PGC-1α upregulation by 66% in heart and 2.3-fold in skeletal muscle)

  • Activation of the mitochondrial unfolded protein response

  • Upregulation of the Nrf2 antioxidant pathway

  These mechanisms, which appear conserved across species, represent potential therapeutic targets independent of direct SURF1 replacement .

• Cross-species drug screening: CRISPR-engineered zebrafish SURF1 models have already identified FDA-approved drugs that could be repurposed for treating SURF1-related Leigh syndrome, suggesting that comparative screening including chicken SURF1 models could yield additional therapeutic candidates .

When applying these insights to human therapies, researchers must account for species-specific differences in SURF1 function and metabolic responses while leveraging the significant evolutionary conservation of this critical mitochondrial assembly factor .

What analytical methods best evaluate the functional equivalence of chicken and human SURF1 for cross-species research applications?

To rigorously assess functional equivalence between chicken and human SURF1, researchers should employ multiple complementary analytical methods:

• Biochemical assays:

  • COX activity measurements comparing rescue efficiency in SURF1-deficient systems

  • Complex IV assembly analysis using blue native PAGE

  • Mitochondrial respiration measurements via high-resolution respirometry

• Structural biology approaches:

  • Comparative protein modeling and X-ray crystallography

  • Hydrogen-deuterium exchange mass spectrometry to compare dynamic regions

  • Circular dichroism to assess secondary structure similarities

• Interaction profiling:

  • Comparative interactome analysis using IP-MS or proximity labeling

  • Yeast two-hybrid screening with species-matched and cross-species prey libraries

  • Surface plasmon resonance to quantify binding affinities to conserved partners

• Functional complementation:

  • Cross-species rescue experiments in SURF1-deficient cell lines

  • Animal model studies comparing phenotypic rescue

  • Domain-swapping experiments to identify functionally interchangeable regions

• Phenotypic response analysis:

  • Comparative stress response profiling

  • Mitochondrial morphology assessment

  • Mitochondrial membrane potential measurements

The most comprehensive approach would integrate data from multiple methods to establish a functional equivalence index that accounts for both similarities and differences between chicken and human SURF1 .

What emerging research directions are likely to increase demand for recombinant chicken SURF1 among researchers?

Several emerging research directions point to increased future demand for recombinant chicken SURF1:

• Evolutionary mitochondrial biology: Comparative studies across species are revealing how evolutionary pressures have shaped mitochondrial assembly factors like SURF1. Chicken SURF1, representing an avian lineage, provides a valuable comparative point between mammalian and other vertebrate mitochondrial systems .

• Mitochondrial stress response mechanisms: The discovery that SURF1 deficiency triggers specific mitochondrial stress responses (UPR^MT and Nrf2 pathway activation) has opened new research avenues exploring how these responses vary across species and tissues .

• Therapeutic development platforms: As gene therapy for SURF1-related disorders advances, comparative studies with chicken SURF1 may identify beneficial structural or functional features that could enhance therapeutic constructs .

• Agriculture and poultry science: Understanding chicken SURF1 function has implications for poultry health and productivity, particularly as it relates to metabolic efficiency and stress responses. This represents a growing research area with economic significance .

• Mitochondrial disease modeling: The development of novel animal models for SURF1-related disorders, including zebrafish and improved mouse models, will likely increase demand for comparative studies using recombinant proteins from multiple species, including chicken .