Recombinant Chicken Surfeit locus protein 4 (SURF4)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Chicken Surfeit Locus Protein 4 (SURF4)

Recombinant Chicken Surfeit locus protein 4 (SURF4) is a bioengineered version of the native SURF4 protein, produced in bacterial systems (e.g., E. coli) for research and therapeutic applications. SURF4 is an integral membrane protein localized to the endoplasmic reticulum (ER) and Golgi apparatus, functioning as a cargo receptor that facilitates ER-to-Golgi trafficking of soluble proteins, including lipoproteins (e.g., VLDL) and proprotein convertase subtilisin/kexin type 9 (PCSK9) . The chicken recombinant variant retains structural and functional similarities to mammalian SURF4, enabling its use in cross-species studies and biochemical assays.

Functional Mechanisms

SURF4 mediates protein trafficking through two primary pathways:

  1. Anterograde ER-to-Golgi Transport

    • Recognizes ER-ESCAPE motifs in cargo proteins (e.g., DSPP, AMELX) via its luminal domain .

    • Interacts with Sec24 subunits of COPII vesicles to load cargo into vesicles .

    • Participates in tubular ER-Golgi networks for bulk protein transport .

  2. Retrograde Golgi-to-ER Transport

    • Utilizes a C-terminal di-lysine motif to interact with COPI vesicles, ensuring recycling to the ER .

    • Critical for retrograde trafficking of proteins like STING and α1-antitrypsin .

Research Applications

Recombinant Chicken SURF4 is employed in studies investigating:

  • Lipid Metabolism: SURF4 deficiency in mice reduces VLDL secretion and plasma cholesterol, suggesting its role in atherosclerosis prevention .

  • Viral Replication: SURF4 interacts with double-membrane vesicles (DMVs) in positive-strand RNA viruses (e.g., HCV), making it a potential antiviral target .

  • Cancer and Exosome Biology: Identified in gastrointestinal stromal tumor-derived exosomes (GDEs), linking SURF4 to intercellular signaling .

Therapeutic and Diagnostic Potential

SURF4’s role in lipid metabolism and viral replication positions it as a candidate for:

  • Dyslipidemia: Inhibiting SURF4 may reduce VLDL secretion without hepatic toxicity .

  • Infectious Diseases: Targeting SURF4 could disrupt viral DMV formation .

  • Cancer: SURF4’s presence in exosomes may enable diagnostic biomarker development .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will prepare according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
SURF4; Surfeit locus protein 4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-269
Protein Length
full length protein
Species
Gallus gallus (Chicken)
Target Names
SURF4
Target Protein Sequence
MGQNDIMSTAEDFADQFLRVTKQYLPHVARLCLISTFLEDGIRMWFQWSEQRDYIDGTWN CGYFLASIFVFINLFGQLSGCILVLSRNFVQYACFGLFGIIALQTIAYSILWDLKFLMRN LALGGGLLLLLAESRSEGKSMFAGVPTMRESSPKQYMQLGGRVLLVLMFMTLLHFDMNFF YILQNIVGTALIILVAIGFKTKLAALTLVIWLFGINIYFNAFWTIPAYKPMHDFLKYDFF QTMSVIGGLLLVVALGPGGVSMDEKKKEW
Uniprot No.

Target Background

Function
Surfeit Locus Protein 4 (SURF4), also known as Endoplasmic Reticulum (ER) cargo receptor, plays a crucial role in lipoprotein export. It facilitates the recruitment of cargos into COPII vesicles, enabling their secretion. SURF4 acts as a cargo receptor for lipoproteins containing both APOB and APOA1, thereby regulating lipoprotein delivery and maintaining lipid homeostasis.
Database Links
Protein Families
SURF4 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Endoplasmic reticulum-Golgi intermediate compartment membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is SURF4 and what are its primary cellular functions?

SURF4 (Surfeit locus protein 4) is a transmembrane cargo receptor that plays a crucial role in the early secretory pathway, particularly in protein trafficking from the endoplasmic reticulum (ER) to the Golgi apparatus. It facilitates the efficient export of specific soluble cargo proteins from the ER by acting as a transmembrane bridge between these proteins and the cytosolic COPII coat components .

SURF4 functions primarily by:

  • Recognizing N-terminal motifs (ER-ESCAPE motifs) of soluble cargo proteins after signal peptide cleavage

  • Co-clustering with selected cargoes at ER-exit sites (ERES)

  • Facilitating the formation of specialized transport carriers

  • Expediting ER-to-Golgi transport for specific soluble cargoes

Studies have demonstrated that SURF4 is particularly involved in transporting proteins such as PCSK9 and apolipoprotein B (APOB), playing significant roles in lipoprotein metabolism and cholesterol homeostasis .

How is the structure of chicken SURF4 characterized compared to mammalian homologs?

While the search results don't provide specific structural information about chicken SURF4, comparative analysis with other species suggests conservation of key functional domains. The full-length Pongo abelii (orangutan) SURF4 protein consists of 269 amino acids , which likely represents a similar length to chicken SURF4.

The general structure of SURF4 includes:

  • Multiple transmembrane domains that anchor the protein in the ER membrane

  • Lumen-facing domains that interact with cargo proteins

  • Cytosolic domains that interact with COPII components

Recent structural prediction-guided mutagenesis and site-specific cross-linking studies have identified a putative ER-ESCAPE interaction surface on SURF4, mapped to an ER lumen-facing pocket . This structural feature is likely conserved across species, including chicken SURF4, though species-specific variations may exist.

What expression systems are most effective for producing recombinant chicken SURF4?

Based on available information about recombinant SURF4 production, several expression systems can be considered for chicken SURF4:

Expression SystemAdvantagesConsiderationsApplication
E. coli- High yield
- Cost-effective
- Rapid production
- May lack post-translational modifications
- Potential for inclusion bodies
Structural studies, antibody production
Mammalian cells (HEK293)- Proper folding
- Post-translational modifications
- Functional studies
- Higher cost
- Lower yield
- More complex protocols
Functional assays, protein interaction studies
Insect cells- High expression levels
- Eukaryotic processing
- Scalable
- Intermediate cost
- More complex than bacterial systems
Structural and functional studies

For recombinant SURF4 production, E. coli has been successfully used to express full-length SURF4 from Pongo abelii with an N-terminal His tag . This suggests that bacterial expression systems could be viable for chicken SURF4 production, particularly when the experimental goal is to obtain protein for structural studies or antibody production.

For functional studies where proper folding and post-translational modifications are critical, mammalian expression systems like HEK293 cells might be more appropriate, as these have been successfully used in SURF4 research .

What purification strategies yield the highest purity and activity for recombinant chicken SURF4?

While specific purification protocols for chicken SURF4 are not detailed in the search results, general approaches for membrane proteins like SURF4 can be outlined:

  • Affinity Chromatography: For His-tagged SURF4 (as used with Pongo abelii SURF4 ), nickel or cobalt affinity chromatography is the primary purification step.

  • Buffer Optimization: The search results indicate that purified SURF4 can be stored in Tris/PBS-based buffer with 6% trehalose at pH 8.0 .

  • Detergent Selection: As SURF4 is a membrane protein, appropriate detergents are crucial for maintaining solubility while preserving native structure.

  • Purity Assessment: SDS-PAGE analysis can confirm protein purity, with >90% purity being achievable .

  • Storage Conditions: Lyophilization is suitable for long-term storage, with reconstitution in deionized sterile water to 0.1-1.0 mg/mL. Addition of 5-50% glycerol is recommended for aliquots stored at -20°C/-80°C .

Recommended Protocol:

  • Initial capture using affinity chromatography

  • Buffer exchange to remove imidazole

  • Optional size exclusion chromatography for higher purity

  • Quality control via SDS-PAGE and functional assays

  • Storage with cryoprotectants to maintain activity

What methods are most reliable for studying the interaction between chicken SURF4 and the COPII machinery?

Based on research findings, interactions between SURF4 and COPII components are critical for its function as a cargo receptor. To study these interactions with chicken SURF4:

  • Co-immunoprecipitation Assays: These can identify interactions between SURF4 and COPII components, particularly SEC24 isoforms. Studies have shown that different SURF4 cargoes may utilize different SEC24 isoforms (e.g., Cab45/NUCB1 use SEC24C/D while PCSK9 uses SEC24A) .

  • Live-Cell Imaging of ER Exit Sites: Fluorescently tagged SURF4 and COPII components can be tracked to visualize their co-localization and dynamics at ER exit sites.

  • In Vitro Binding Assays: Purified components can be used to determine direct binding affinities and requirements.

  • Yeast Two-Hybrid or Mammalian Two-Hybrid Systems: These can screen for interacting partners or validate specific interactions.

  • CRISPR/Cas9-Mediated Gene Editing: Creating knockouts or mutations in specific COPII components can reveal their role in SURF4-mediated transport.

Key experimental considerations include:

  • Different SURF4 cargoes may require different co-receptors (e.g., PCSK9 requires TMED10)

  • Cargo-specific requirements for SEC24 isoforms suggest complex regulatory mechanisms

  • Both luminal cargo binding and cytosolic COPII interactions must be preserved for proper function

How does chicken SURF4 contribute to the formation of specialized transport carriers?

Research indicates that SURF4 plays a critical role in forming specialized transport carriers, particularly tubular ER-Golgi intermediate compartments (t-ERGIC). While specific information about chicken SURF4 is not provided, general mechanisms likely apply across species:

SURF4 induces the formation of tubular ERGIC (t-ERGIC) that specifically accelerates ER-to-Golgi transport of SURF4-bound soluble cargoes . These specialized carriers:

  • Lack the canonical ERGIC marker ERGIC-53 but are positive for the small GTPases Rab1A/B

  • Feature an extraordinarily elongated and thinned shape with large surface-to-volume ratio

  • Travel at high intracellular speeds with ER-Golgi recycling capabilities

  • Are generated at expanded ER exit sites (ERES) through SURF4-cargo interactions

The biogenesis of these carriers depends on SURF4's ability to recognize the N-terminus of soluble cargoes and co-cluster with selected cargoes, expanding the ER exit sites . In steady state, this fast transport system is counterbalanced by KDEL-mediated ER retrieval mechanisms .

To study these specialized carriers experimentally, researchers could:

  • Express fluorescently tagged chicken SURF4 and visualize carrier formation

  • Compare morphology and dynamics of carriers induced by chicken versus mammalian SURF4

  • Analyze cargo selectivity and transport kinetics in these specialized carriers

What is the relationship between chicken SURF4 function and the tubular ERGIC transport system?

The tubular ERGIC (t-ERGIC) represents a distinct transport pathway that depends on SURF4 function. Research findings indicate that:

  • SURF4 induces formation of t-ERGIC distinct from canonical ERGIC/VTCs

  • t-ERGIC selectively accelerates trafficking of SURF4-bound soluble cargoes

  • The extreme morphology (elongated and thinned shape) creates a large surface-to-volume ratio facilitating rapid transport

  • The system enables efficient ER-to-Golgi transport through high traveling speeds and recycling capabilities

This specialized transport system highlights how cargo-receptor interactions can give rise to distinct transport carriers that regulate trafficking kinetics . The t-ERGIC system represents an important paradigm in understanding how cells can adapt their secretory pathway for specific cargo types.

Experimental approaches to study this relationship include:

  • Live cell imaging to track t-ERGIC formation and dynamics

  • Cargo-specific transport assays to measure kinetics

  • Comparative studies between different SURF4 orthologs (including chicken) to identify conserved mechanisms

What evidence exists regarding chicken SURF4's role in lipoprotein metabolism compared to mammalian models?

While specific information about chicken SURF4's role in lipoprotein metabolism is not provided in the search results, significant insights from mammalian models suggest potential comparable functions:

Studies in hepatic SURF4-deficient mice (Surf4<sup>fl/fl</sup> Alb-Cre<sup>+</sup>) have revealed critical roles for SURF4 in lipoprotein metabolism :

  • SURF4 facilitates secretion of PCSK9, a protein that negatively regulates low-density lipoprotein receptor (LDLR) abundance on cell surfaces

  • Hepatic inactivation of SURF4 in mice resulted in:

    • ~60% reduction in plasma PCSK9 levels

    • ~50% increase in steady-state LDLR protein abundance in the liver

    • Marked reduction in plasma cholesterol and triglyceride levels

    • Severe defect in hepatic lipoprotein secretion

  • SURF4 also promotes the secretion of apolipoprotein B (APOB)

These findings suggest SURF4 has dual roles in lipoprotein metabolism: facilitating PCSK9 secretion (which regulates LDLR levels) and directly supporting secretion of APOB-containing lipoproteins .

For researchers interested in chicken SURF4, comparative studies could reveal:

  • Whether avian SURF4 plays similar roles in lipoprotein metabolism

  • Species-specific adaptations in SURF4 function related to differences in avian versus mammalian lipid metabolism

  • Potential therapeutic implications for targeting SURF4 in models of atherosclerotic cardiovascular diseases

How can researchers effectively measure and interpret changes in secretory dynamics when modulating chicken SURF4 expression?

To effectively study secretory dynamics when modulating chicken SURF4 expression, researchers can employ various complementary approaches:

  • Pulse-Chase Analysis: Metabolic labeling followed by chase periods can quantify secretion kinetics for specific SURF4 cargoes.

  • Immunoblotting of Intracellular and Secreted Proteins: Measuring cargo levels in cell lysates versus culture media provides a direct measure of secretory efficiency.

  • Live-Cell Imaging: Fluorescently tagged cargo proteins can be tracked in real-time to visualize trafficking dynamics.

  • Mass Spectrometry-Based Secretome Analysis: This approach can provide comprehensive profiles of secreted proteins under different SURF4 expression conditions.

  • CRISPR/Cas9 or siRNA-Mediated Knockdown: Acute depletion methods provide valuable insights, as demonstrated in hepatic SURF4 studies using CRISPR/Cas9 or liver-targeted siRNA .

Data Interpretation Framework:

ParameterNormal SURF4SURF4 DepletionSURF4 Overexpression
PCSK9 SecretionBaselineReduced (~60% in mice) Potentially increased
LDLR AbundanceBaselineIncreased (~50% in mice) Potentially decreased
Lipoprotein SecretionBaselineSeverely reduced Potentially enhanced
ER Stress MarkersBaselineMay increaseVariable
Trafficking SpeedNormalSlower for SURF4 cargoesPotentially accelerated

Researchers should consider:

  • Different cargoes may show varying degrees of dependence on SURF4

  • Compensatory mechanisms may emerge during long-term SURF4 depletion

  • Acute versus chronic SURF4 modulation may yield different phenotypes

What mechanisms underlie the co-translational engagement of chicken SURF4 with its cargo proteins?

Research using in vitro translation and site-specific photo-crosslinking has revealed important insights into SURF4's molecular mechanisms:

SURF4 directly engages with cargo proteins co-translationally via an N-terminal ER-ESCAPE motif that becomes exposed after signal peptide cleavage . This represents a rapid export mechanism that may prevent improper cargo oligomerization in early secretory organelles .

Key findings about this process include:

  • Direct Co-translational Interaction: This is the first demonstration that a cargo receptor can interact with an unfolded and incompletely translated client protein .

  • N-terminal Recognition: SURF4 specifically recognizes the N-terminus of soluble cargoes following signal peptide cleavage .

  • Structural Basis: A putative ER-ESCAPE interaction surface on SURF4 has been mapped to an ER lumen-facing pocket through structural prediction-guided mutagenesis and site-specific cross-linking .

  • Cargo Selection: SURF4 preferentially binds oligomeric Ca²⁺-binding proteins, including Cab45 and NUCB1, among other clients .

For chicken SURF4, researchers would need to determine if these mechanisms are conserved. The co-translational engagement mechanism represents an important paradigm in understanding how cells ensure efficient and accurate sorting of secretory proteins from the earliest stages of protein synthesis.

How do different SURF4 cargoes utilize distinct SEC24 isoforms, and what are the implications for chicken SURF4 research?

Research has revealed that SURF4 exhibits remarkable complexity in how it interfaces with the COPII machinery, particularly regarding SEC24 isoform utilization:

  • Cargo-Specific SEC24 Utilization: Different SURF4 cargoes employ distinct SEC24 isoforms:

    • Cab45 and NUCB1 utilize SEC24C/D isoforms

    • PCSK9 exclusively employs SEC24A

  • Co-Receptor Requirements: This cargo-specific SEC24 utilization appears to involve co-receptors:

    • PCSK9 requires TMED10 as a co-receptor for its interaction with SURF4 and subsequent use of SEC24A

  • Multiple Engagement Mechanisms: ER export via SURF4 uses diverse mechanisms of both client and COPII adaptor engagement , suggesting sophisticated cargo-specific regulation.

These findings have several implications for chicken SURF4 research:

  • Researchers should investigate whether chicken SURF4 exhibits similar cargo-specific SEC24 isoform preferences

  • Studies should examine potential avian-specific co-receptors that might facilitate SURF4-cargo-COPII interactions

  • The diversity in cargo-specific mechanisms suggests that functional assays should incorporate multiple cargo types to fully characterize chicken SURF4 activity

This complex interplay between cargo, SURF4, co-receptors, and SEC24 isoforms represents an area where species-specific differences might emerge, making comparative studies between chicken and mammalian SURF4 particularly valuable.

What are the critical quality control parameters for recombinant chicken SURF4 preparation?

Based on information about recombinant SURF4 production, several critical quality control parameters should be monitored:

  • Purity Assessment: SDS-PAGE analysis should confirm protein purity greater than 90% .

  • Protein Integrity: Western blotting using anti-SURF4 and anti-tag antibodies can verify full-length expression and intact termini.

  • Proper Folding: Circular dichroism spectroscopy can assess secondary structure content appropriate for a multi-pass transmembrane protein.

  • Functional Activity: Cargo binding assays using known SURF4 substrates should demonstrate biological activity.

  • Oligomeric State: Size exclusion chromatography and/or native PAGE can determine whether the protein exists in the expected oligomeric state.

Quality Control Checklist:

  • Verify protein identity by mass spectrometry

  • Confirm N-terminal and C-terminal integrity

  • Assess detergent selection and protein stability

  • Validate functional cargo binding activity

  • Ensure batch-to-batch consistency

For storage and handling, recombinant SURF4 should be stored at -20°C/-80°C, with aliquoting recommended to avoid repeated freeze-thaw cycles. Working aliquots can be maintained at 4°C for up to one week . For long-term storage, addition of 5-50% glycerol is recommended .

What are the common challenges in studying chicken SURF4 function, and how can researchers address them?

While the search results don't specifically address challenges with chicken SURF4, general challenges in SURF4 research can be extrapolated:

  • Membrane Protein Expression and Solubilization:

    • Challenge: As a multi-pass transmembrane protein, SURF4 can be difficult to express and purify in a functional state.

    • Solution: Optimize expression conditions (temperature, induction time), screen multiple detergents, and consider fusion tags that enhance solubility.

  • Cargo Binding Assays:

    • Challenge: Developing reliable assays to measure SURF4-cargo interactions.

    • Solution: Employ multiple complementary approaches (co-IP, crosslinking, surface plasmon resonance) and validate with known SURF4 substrates.

  • Distinguishing Direct vs. Indirect Effects:

    • Challenge: Determining whether phenotypes in SURF4-depleted systems are due to direct cargo effects or secondary consequences.

    • Solution: Use acute depletion methods (as demonstrated with liver-targeted siRNA ) and rescue experiments with wild-type vs. mutant SURF4.

  • Species-Specific Differences:

    • Challenge: Extrapolating from mammalian studies to avian systems.

    • Solution: Perform comparative analyses of chicken vs. mammalian SURF4 sequences and validate key findings in avian cell systems.

  • Co-Receptor Complexity:

    • Challenge: Identifying potential co-receptors required for specific cargo transport.

    • Solution: Systematic proteomics approaches to identify SURF4 interactors and targeted disruption of candidate co-receptors.

Troubleshooting Table:

IssuePossible CauseSolution
Low protein yieldExpression conditionsOptimize temperature, induction time, host strain
Poor solubilityInadequate detergentScreen detergent panel for optimal extraction
No cargo bindingDenatured proteinVerify proper folding, try milder solubilization
Inconsistent resultsBatch variationImplement rigorous quality control measures
Non-specific effectsOff-target effectsUse multiple knockdown approaches and rescue experiments

What emerging technologies could advance our understanding of chicken SURF4 function and regulation?

Several cutting-edge technologies could significantly advance research on chicken SURF4:

  • Cryo-Electron Microscopy (Cryo-EM): This could resolve the structure of chicken SURF4 alone or in complex with cargo and COPII components, revealing species-specific structural features and molecular mechanisms.

  • AlphaFold and Other AI Structure Prediction Tools: These could generate high-confidence structural models of chicken SURF4 and predict cargo interaction interfaces, guiding experimental design.

  • Genome-Wide CRISPR Screens: These could identify novel regulators and interactors of chicken SURF4 in avian cell systems.

  • Super-Resolution Microscopy: Techniques like STORM or PALM could visualize SURF4-dependent tubular ERGIC formation with unprecedented detail in avian cells.

  • Proximity Labeling Proteomics: BioID or APEX2 fusions with chicken SURF4 could map its protein interaction network in the native cellular environment.

  • Single-Cell Secretome Analysis: This could reveal cell-to-cell variability in SURF4-dependent secretion and identify subpopulations with distinct secretory behaviors.

  • Organoid Systems: Avian organoids could provide physiologically relevant models to study SURF4 function in tissue-specific contexts.

These technologies could address key questions such as:

  • How does chicken SURF4 structure compare to mammalian homologs?

  • Are there avian-specific SURF4 cargoes or regulatory mechanisms?

  • How does SURF4 function integrate with other aspects of the avian secretory pathway?

How might comparative studies between avian and mammalian SURF4 inform evolutionary adaptations in the secretory pathway?

Comparative studies between avian and mammalian SURF4 could reveal important insights into the evolution of the secretory pathway:

  • Cargo Repertoire Evolution: Different species may have evolved specialized SURF4-dependent secretion for distinct physiological needs. For example, the role of SURF4 in lipoprotein metabolism might show adaptations related to differences in avian versus mammalian lipid physiology.

  • Structural Adaptations: Comparing the cargo-binding domains and COPII-interaction regions across species could reveal evolutionary constraints and adaptations in these functional regions.

  • Regulatory Network Divergence: The mechanisms regulating SURF4 expression and activity might differ between species, reflecting distinct physiological demands on the secretory pathway.

  • Co-receptor Utilization: The finding that SURF4 requires co-receptors like TMED10 for certain cargoes raises questions about whether such partnerships are conserved across species.

  • Specialized Transport Carriers: The SURF4-induced tubular ERGIC might show species-specific optimizations in morphology or dynamics.

Research approaches could include:

  • Phylogenetic analysis of SURF4 sequences across vertebrate lineages

  • Cross-species complementation studies (can chicken SURF4 rescue mammalian SURF4 deficiency?)

  • Comparative secretome analysis in avian versus mammalian cells expressing or lacking SURF4

  • Structural studies examining cargo recognition specificity across species

Such comparative analyses would not only illuminate the evolution of the secretory pathway but could also identify conserved core functions versus species-specific adaptations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.