Recombinant Chicken Tetraspanin-12 (TSPAN12)

Shipped with Ice Packs
In Stock

Description

Norrin/FZD4 Pathway Activation

  • TSPAN12 acts as a co-receptor for Norrin, promoting FZD4 multimerization and β-catenin accumulation via Wnt-independent pathways .

  • Enhances ligand selectivity: The LEL directly captures Norrin, enabling high-affinity binding to FZD4 and LRP5/6 co-receptors .

  • Rescues signaling defects in FZD4 mutants (e.g., M105V) linked to familial exudative vitreoretinopathy (FEVR) .

Angiogenesis and Blood-Retina Barrier (BRB)

  • Critical for retinal vascularization: Knockout models show abnormal arterial-venous crossing and reduced intraretinal capillaries .

  • Maintains BRB integrity by regulating VE-cadherin expression and endothelial cell (EC) activity .

Research Applications

Recombinant Chicken TSPAN12 is utilized in:

  1. In vitro signaling assays: Measures Norrin-induced β-catenin activation .

  2. Disease modeling: FEVR-linked mutations (e.g., G188R, L201F) disrupt TSPAN12-FZD4 interactions .

  3. Structural studies: Chimera constructs (e.g., TSPAN12-LEL11) identify loop-specific functions .

ApplicationExperimental OutcomeSource
Rescue assays (NDP C95R)TSPAN12 restores 70% of signaling activity
Cell surface biotinylationTSPAN12 Y138C reduces FZD4 membrane localization
RNA-Seq in EC-specific KOECM dysregulation mimics diabetic retinopathy

Key Research Findings

  • Mechanistic Insight: TSPAN12 stabilizes the Norrin-FZD4-LRP5/6 complex, enhancing signalosome assembly .

  • Pathological Relevance: FEVR-associated TSPAN12 mutations (e.g., Y138C) impair FZD4 trafficking and barrier function .

  • Therapeutic Potential: Overexpression rescues vascular defects in murine models .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the available format, please specify your preferred format in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Tag type is determined during production. Please specify your required tag type for preferential development.
Synonyms
TSPAN12; RCJMB04_27b23; Tetraspanin-12; Tspan-12
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-305
Protein Length
full length protein
Species
Gallus gallus (Chicken)
Target Names
TSPAN12
Target Protein Sequence
MAREDSVRCLRCLLYALNLLFWLMSISVLGVSAWIRDYLNNVLTLTAETRVEEAVILTYF PVVHPVMIAVCCFLILVGMLGYCGTVKRNLLLLVWYFGSLLVIFCVELACGVWTYEQEIT VPVQWSDMITLKARMTNYGLPRYQWLTHAWNFFQREFKCCGVVYFTDWLEMTEMDWPPDS CCVREFPGCSKQAHHEDLSDLYQEGCGKKMYTFLRGTKQLQVLRFLGISIGVTQILAMIL TITLLWALYYDRRDPGADQIMSLKNDTSQQLSCHSVELLKPSLTGIFEHTSMANSFNTHF EMEEL
Uniprot No.

Target Background

Function

Recombinant Chicken Tetraspanin-12 (TSPAN12) is a regulator of cell surface receptor signal transduction. It plays a crucial role in retinal vascularization by modulating norrin (NDP) signal transduction. TSPAN12 works with norrin (NDP) to facilitate FZD4 multimerization and subsequent activation, leading to increased beta-catenin (CTNNB1) accumulation and stimulation of LEF/TCF-mediated transcriptional programs. Notably, TSPAN12 exclusively activates norrin (NDP)-dependent FZD4 activation, without affecting Wnt-dependent activation. This suggests the existence of a Wnt-independent signaling pathway that also promotes beta-catenin (CTNNB1) accumulation.

Database Links
Protein Families
Tetraspanin (TM4SF) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure and function of Chicken TSPAN12?

Chicken TSPAN12 belongs to the tetraspanin family (transmembrane 4 superfamily) characterized by four hydrophobic transmembrane domains. This cell-surface protein mediates signal transduction events that regulate cell development, activation, growth, and motility . TSPAN12 has a distinctive evolutionary position as one of the earliest tetraspanins with a phylogenetically atypical long C-terminal tail . Its key molecular functions include protein binding and notably, it does NOT have Wnt-activated receptor activity directly, despite its involvement in Wnt signaling pathways .

Which expression systems are optimal for producing recombinant Chicken TSPAN12?

Multiple expression systems can be utilized for recombinant Chicken TSPAN12 production, each with specific advantages:

Expression SystemAdvantagesConsiderations
E. coliHigher yields, shorter production timeLimited post-translational modifications
YeastGood yields, moderate production timeSome post-translational modifications
Insect cells with baculovirusBetter protein folding, many post-translational modificationsLonger production time
Mammalian cellsMost native-like modifications, optimal foldingLower yields, longer production time

For structural studies or applications where post-translational modifications are critical for function, insect or mammalian expression systems are recommended despite lower yields .

What purification strategies work best for recombinant Chicken TSPAN12?

Purification of recombinant Chicken TSPAN12 typically employs affinity chromatography using tags such as His, GST, DDK, Myc, Avi, or Fc, which can be engineered into the expression construct . For membrane proteins like TSPAN12, initial purification under denaturing conditions using Ni-NTA resin (for His-tagged proteins) followed by carefully controlled dialysis improves solubility and proper folding . Multi-step purification protocols combining affinity chromatography with size exclusion chromatography can enhance purity while maintaining protein activity.

How does TSPAN12 influence canonical Wnt signaling pathways in avian models?

TSPAN12 plays a critical role in the canonical Wnt signaling pathway by stabilizing the interaction between FZD4 (Frizzled 4) and its co-receptor LRP5 . In TSPAN12-deficient conditions, this FZD4-LRP5 association is substantially diminished, leading to enhanced proteasomal degradation of β-catenin, a key effector of canonical Wnt signaling . While most studies have been conducted in mammalian models, the conserved nature of these pathways suggests similar mechanisms in avian systems.

For experimental investigation in chicken models, researchers should focus on:

  • Co-immunoprecipitation assays to detect FZD4-LRP5 interactions

  • Proteasome inhibition studies (e.g., using MG132) to assess β-catenin degradation

  • Subcellular localization studies to track β-catenin nuclear translocation

What role does Chicken TSPAN12 play in vascular development and related disorders?

TSPAN12 is crucial for normal vascular development, with mutations linked to impaired vascularization of the eye in human familial exudative vitreoretinopathy (FEVR) . TSPAN12 collaborates with Norrin (NDP), FZD4, and LRP5 to activate the Norrin/β-catenin signaling pathway essential for retinal vascular development .

For investigating TSPAN12's role in avian vascular development:

  • Use CRISPR/Cas9 to generate TSPAN12-deficient chicken embryos

  • Employ chorioallantoic membrane (CAM) assays to evaluate vascular formation

  • Utilize immunohistochemistry with vascular markers (CD31, VE-cadherin) to assess vascular network complexity

  • Compare vascular phenotypes with known Wnt/β-catenin pathway modulators

How do post-translational modifications affect Chicken TSPAN12 function?

Post-translational modifications (PTMs) are critical for proper TSPAN12 function. When expressing recombinant Chicken TSPAN12, researchers should consider:

  • Glycosylation patterns that affect protein folding and cell surface localization

  • Palmitoylation of cysteine residues that influences tetraspanin clustering and protein-protein interactions

  • Phosphorylation sites that may regulate signaling activity

Expression in mammalian or insect cell systems provides the necessary cellular machinery for these modifications, which are crucial for biological activity . To study PTM effects, researchers can:

  • Create point mutations at predicted modification sites

  • Use glycosylation inhibitors (tunicamycin) or palmitoylation inhibitors (2-bromopalmitate)

  • Employ mass spectrometry to map actual modification patterns

What methodologies are most effective for studying TSPAN12's role in tumor growth and metastasis?

Research indicates that TSPAN12 supports primary tumor growth while suppressing metastasis . Studies show that ablation of TSPAN12 from human MDA-MB-231 cells significantly decreased primary tumor xenograft growth while increasing metastasis to mouse lungs .

For investigating Chicken TSPAN12 in oncology research:

  • Develop stable chicken cell lines with TSPAN12 knockdown/overexpression

  • Utilize xenograft models to evaluate both primary tumor growth and metastatic potential

  • Assess β-catenin signaling via reporter assays and downstream gene expression analysis

  • Examine tumor-endothelial interactions through co-culture systems and adhesion assays

  • Monitor expression of β-catenin-regulated genes (CCNA1, CCNE2, WISP1, ID4, SFN, ME1) as biomarkers

How can I design definitive experiments to determine if Chicken TSPAN12 interacts with ADAM10?

ADAM10 (a disintegrin and metalloprotease 10) has been implicated as a TSPAN12-interacting protein . To investigate this interaction in chicken models:

  • Perform co-immunoprecipitation assays using antibodies against Chicken TSPAN12 and ADAM10

  • Employ proximity ligation assays to visualize protein interactions in situ

  • Use FRET or BRET techniques to assess protein interactions in living cells

  • Evaluate ADAM10 substrate processing (e.g., Notch, APP) in the presence/absence of TSPAN12

  • Create deletion mutants to map interaction domains

What gene expression changes result from TSPAN12 modulation and how can they be analyzed?

TSPAN12 ablation alters expression of over 400 genes, including several key genes regulated by β-catenin pathway . For comprehensive analysis of gene expression changes:

  • Utilize RNA-Seq or microarray analysis comparing wild-type and TSPAN12-modulated samples

  • Perform pathway enrichment analysis focusing on Wnt/β-catenin, TGFβ, and other signaling pathways

  • Validate key gene expression changes using qRT-PCR

  • Examine protein levels of pathway components (LRP5, Naked 1 and 2, DVL2, DVL3, Axin 1, GSKβ3) via western blotting

  • Use ChIP-seq to identify direct β-catenin transcriptional targets affected by TSPAN12 status

How can I confirm the functional activity of purified recombinant Chicken TSPAN12?

Validating functional activity of recombinant TSPAN12 requires multiple approaches:

  • FZD4-LRP5 co-immunoprecipitation assays to demonstrate TSPAN12's ability to stabilize this interaction

  • β-catenin stabilization assays in TSPAN12-deficient cells rescued with recombinant protein

  • TOPFlash/FOPFlash reporter assays to measure Wnt/β-catenin signaling activation

  • Immunoblotting for downstream targets of β-catenin signaling

  • Immunofluorescence to confirm proper membrane localization

What are common issues in TSPAN12 protein production and how can they be resolved?

ProblemPossible CauseSolution
Low expression yieldsProtein toxicity, inefficient translationTry inducible expression systems, codon optimization
Protein aggregationImproper folding, hydrophobic domainsUse mild detergents, optimize solubilization conditions
Loss of functionMissing post-translational modificationsSwitch to eukaryotic expression systems
DegradationProtease sensitivityInclude protease inhibitors, optimize purification speed
Poor solubilityMembrane protein characteristicsUse specialized detergents (DDM, CHAPS, OG)

For challenging membrane proteins like TSPAN12, consider using nanodiscs or amphipols to maintain native-like environment during purification and functional studies.

How conserved is Chicken TSPAN12 compared to mammalian orthologs?

TSPAN12 is phylogenetically one of the earliest tetraspanins with pre-chordate ancestry . While specific chicken-to-mammal comparisons aren't detailed in the search results, the functional conservation of Wnt signaling components suggests significant structural and functional conservation. Researchers should perform sequence alignments and structural modeling to identify:

  • Conservation of transmembrane domains

  • Preservation of key interaction residues (especially those involved in FZD4/LRP5 binding)

  • Evolutionary differences that might affect function or binding partners

  • Conservation of post-translational modification sites

This comparative analysis provides context for translating findings between avian and mammalian models.

What are promising new approaches for studying TSPAN12 function in development and disease?

Emerging technologies offer new opportunities for TSPAN12 research:

  • Cryo-EM structural studies of TSPAN12 in complex with its binding partners

  • Single-cell transcriptomics to identify cell-specific roles of TSPAN12 in heterogeneous tissues

  • Organ-on-chip models to study TSPAN12's role in vascular development under controlled conditions

  • In vivo CRISPR screens to identify genetic interactors of TSPAN12

  • Therapeutic targeting of TSPAN12-mediated pathways for vascular disorders and cancer

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.