Recombinant Chicken Thyrotropin-releasing hormone receptor (TRHR)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization of Recombinant Chicken TRHR

Recombinant Chicken TRHR (UniProt ID: O93603) is a 395-amino-acid G protein-coupled receptor (GPCR) produced in E. coli with an N-terminal His tag . Key structural features include:

  • Ligand-binding pocket: Fully conserved transmembrane helices critical for TRH interaction .

  • Functional motifs:

    • ERY motif (Glu-Arg-Tyr) in the third transmembrane domain for G protein coupling.

    • NPXXY motif in the seventh transmembrane domain for receptor activation .

Functional Insights into TRHR Signaling

Chicken TRHR exists in two functional subtypes: TRHR1 (neuroendocrine regulation) and TRHR3 (broad tissue activity) . Both receptors:

  • Bind TRH with high affinity (EC₅₀ in nanomolar range) .

  • Activate multiple signaling pathways, including:

    • Phospholipase C (PLC)/inositol trisphosphate (IP₃) cascade.

    • Extracellular signal-regulated kinase (ERK) phosphorylation .

Gene expression patterns:

  • TRHR1: Highly expressed in anterior pituitary and testes.

  • TRHR3: Abundant in muscle, fat, spinal cord, and hypothalamus .

Receptor Activation and Signaling

  • TRHR3, when expressed in HEK 293 cells, shows potent activation by TRH, comparable to TRHR1 .

  • Both receptors induce calcium mobilization and cAMP inhibition post-TRH binding .

Tissue-Specific Roles

  • Hypothalamic TRHR1: Modulates TSH and prolactin release via pituitary interaction .

  • Muscle TRHR3: Potentially regulates metabolic activity and cold adaptation .

Evolutionary Conservation

  • Chicken TRHR shares 63–81% amino acid identity with reptilian and mammalian homologs but exhibits unique avian-specific features in extracellular loops .

Applications in Avian Physiology Research

Recombinant Chicken TRHR is pivotal for:

  • Ligand-receptor interaction studies: Mapping TRH binding sites using mutagenesis .

  • Hormonal regulation assays: Investigating links between TRH signaling and thyroid hormone synthesis .

  • Comparative genomics: Analyzing TRHR evolution across vertebrates .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference for customer use.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us; we will prioritize its inclusion in production.
Synonyms
TRHR; Thyrotropin-releasing hormone receptor; TRH-R; Thyroliberin receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-395
Protein Length
Full length protein
Species
Gallus gallus (Chicken)
Target Names
Target Protein Sequence
MENGTGDEQNHTGLLLSSQEFVTAEYQVVTILLVLLICGLGIVGNIMVVLVVLRTKHMRT PTNCYLVSLAVADLMVLVAAGLPNITESLYKSWVYGYVGCLCITYLQYLGINASSFSITA FTIERYIAICHPIKAQFLCTFSRAKKIIIFVWSFASVYCMLWFFLLDLNIAVYKDTTVVS CGYKVSRSYYSPIYMMDFGIFYVLPMVLATVLYGLIARILFLNPIPSDPKENSNTWKNDM AQQNKTVNSKMTNKSFNSTIASRRQVTKMLAVVVVLFAFLWMPYRTLVVVNSFLSSPFQE NWFLLFCRICIYLNSAINPVIYNLMSQKFRAAFRKLCNCHLKRDKKPANYSVALNYNVIK ESDHFSSEIEDITVTNTYLSSAKTSIGDTCLSSEA
Uniprot No.

Target Background

Function
The thyrotropin-releasing hormone receptor (TRHR) is a G protein-coupled receptor that binds thyrotropin-releasing hormone (TRH). Ligand binding activates the phosphatidylinositol (IP3)-calcium-protein kinase C (PKC) signaling pathway.
Database Links

KEGG: gga:395770

STRING: 9031.ENSGALP00000025895

UniGene: Gga.457

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the chicken Thyrotropin-releasing hormone receptor (TRHR)?

Chicken TRHR is a G-protein coupled receptor that mediates the effects of Thyrotropin-releasing hormone (TRH) in avian species. This receptor plays a crucial role in regulating thyroid-stimulating hormone (TSH) secretion in chickens. TRH stimulates TSH secretion, whereas other hypothalamic hormones like somatostatin (SRIH) exert inhibitory effects . The receptor contains transmembrane helices that form a ligand binding pocket, which has been found to be highly conserved across vertebrate species . Functionally, chicken TRHR serves as a critical component in the hypothalamic-pituitary-thyroid axis, influencing various physiological processes including metabolism, growth, and development in avian species.

How does chicken TRHR compare structurally to mammalian TRHRs?

Chicken TRHR exhibits remarkable structural conservation with mammalian receptors, particularly in the critical ligand-binding domains. The ligand binding pocket, situated in the transmembrane helices of mouse and rat TRH receptors, is completely conserved in the chicken receptor . This conservation extends to functional properties as well. Pharmacological studies using various TRH analogs revealed no significant differences in receptor binding and signaling between chicken and mouse receptors .

Where is TRHR expressed in chicken tissues and what is its cellular localization?

TRHR in chickens demonstrates specific cellular localization patterns that align with its physiological functions. Research using in situ hybridization (ISH) combined with immunological staining has confirmed that thyrotropes (TSH-secreting cells) in the chicken pars distalis express TRH receptors . This cellular localization allows for direct action of TRH at the level of thyrotropes, mediating its effects on TSH secretion.

The search results indicate that somatostatin subtype 2 receptors (SSTR2) are also expressed in thyrotropes, enabling direct inhibitory action of somatostatin on these cells . In contrast, corticotropin-releasing hormone receptors type 1 (CRH-R1) are primarily confined to corticotropes, suggesting differences in direct vs. indirect hormonal regulation of different pituitary cell types .

While the available research focuses primarily on pituitary expression, TRHR is likely expressed in other tissues as well, given TRH's reported roles in avian growth regulation . Comparative data from other species, such as Xenopus laevis, suggests that different TRHR subtypes might show distinct distribution patterns across tissues, with some subtypes predominant in the brain and others in peripheral tissues .

How can researchers characterize the binding properties and signaling of recombinant chicken TRHR?

Characterizing the binding properties and signaling pathways of recombinant chicken TRHR requires a multi-faceted experimental approach. Based on established receptor pharmacology techniques and information from the search results, researchers should consider the following methods:

Binding Characterization:

  • Radioligand binding assays using labeled TRH to determine binding affinity (Kd) and receptor density (Bmax)

  • Competition binding studies with TRH analogs to assess ligand selectivity

  • Binding kinetics measurements to determine association and dissociation rates

Signaling Pathway Analysis:

  • Measurement of inositol phosphate production, as TRHRs typically couple to the Gq/11 signaling pathway

  • Calcium mobilization assays using fluorescent calcium indicators

  • Evaluation of downstream effector activation (e.g., PKC activity, ERK phosphorylation)

Research has shown that chicken TRHR activation couples to similar signaling pathways as mammalian receptors, particularly the inositol phosphate/calcium pathway . When expressing Xenopus TRHRs in either Xenopus oocytes or HEK-293 cells, all subtypes were found to be fully functional and coupled to this pathway , suggesting similar approaches would be effective for chicken TRHR.

Comparative pharmacological studies have revealed that despite evolutionary distance, chicken TRHR shows similar binding and signaling properties to mouse TRHR when exposed to various TRH analogs , highlighting the remarkable conservation of this receptor's functional mechanisms across vertebrate species.

What are the challenges in studying signal transduction pathways of chicken TRHR?

Investigating signal transduction pathways of chicken TRHR presents several methodological and conceptual challenges:

  • Heterologous Expression Systems: Choosing an appropriate cellular context is crucial. Mammalian cell lines may lack avian-specific signaling components or express them at different levels. Even when using more native contexts, differences in G-protein subunit composition and expression levels can affect signaling outcomes.

  • Receptor Variant Complexities: The presence of truncated forms of chicken TRHR introduces additional complexity. These variants may potentially:

    • Interfere with full-length receptor signaling through heterodimerization

    • Compete for limited G proteins or other signaling components

    • Exhibit differential trafficking or localization

  • Signaling Network Interactions: In vivo, TRHR signaling interacts with multiple other pathways. The search results indicate that TSH secretion in chickens is controlled by several hypothalamic hormones including TRH (stimulatory) and somatostatin (inhibitory) . Understanding these interactions requires sophisticated experimental designs.

  • Desensitization and Receptor Dynamics: Like other GPCRs, TRHR likely undergoes desensitization, internalization, and recycling. The kinetics of these processes may differ between chicken and mammalian receptors, requiring specific techniques for accurate measurement.

  • Limited Availability of Avian-Specific Reagents: Many antibodies and pharmacological tools are designed for mammalian systems and may have reduced efficacy with avian proteins.

Addressing these challenges requires integrated approaches combining molecular biology, cell biology, and sophisticated imaging and biochemical techniques adapted specifically for avian receptor systems.

How do mutations in chicken TRHR affect its function and ligand binding properties?

The effects of mutations in chicken TRHR can be systematically analyzed based on receptor structure-function relationships. While specific mutational studies of chicken TRHR are not detailed in the search results, important inferences can be made based on the high conservation of critical domains:

Ligand Binding Domain Mutations:
The complete conservation of the ligand binding pocket between chicken and mammalian TRHRs suggests that mutations in these residues would have similar effects across species. Typical consequences include:

Mutation LocationPotential Functional Effects
Transmembrane binding pocketAltered binding affinity, reduced efficacy, complete loss of binding
Extracellular loopsModified ligand access, altered binding kinetics
Transmembrane helicesDisrupted receptor conformation, impaired signal transmission

Signaling Domain Mutations:
The search results mention truncated forms of chicken TRHR that are non-functional, particularly those truncated in the putative third intracellular loop . This highlights the critical importance of this region for G-protein coupling and downstream signaling. Mutations in this and other intracellular domains would likely affect:

  • G-protein coupling efficiency

  • Signaling pathway selectivity

  • Receptor phosphorylation and β-arrestin recruitment

  • Internalization and trafficking dynamics

To experimentally characterize the effects of specific mutations, researchers should employ site-directed mutagenesis followed by comprehensive pharmacological characterization, including dose-response studies for both binding and functional readouts. Homology modeling based on crystallized GPCRs can help predict the structural consequences of specific mutations and guide experimental design.

What evolutionary insights can be gained from studying chicken TRHR?

Studying chicken TRHR provides valuable insights into evolutionary aspects of neuroendocrine signaling across vertebrates. The search results reveal several important evolutionary considerations:

  • Remarkable Structural Conservation: The ligand binding pocket of chicken TRHR is completely conserved compared to mouse and rat receptors, despite significant evolutionary distance . This conservation extends to functional properties, as pharmacological studies showed no significant differences between chicken and mouse receptors in response to TRH analogs .

  • Evolutionary Constraints: The high degree of conservation suggests strong selective pressure on TRHR structure and function throughout vertebrate evolution. As stated directly in the research: "These findings show that there have been considerable evolutionary constraints on TRH receptor structure and function" .

  • Receptor Subtype Diversity: While chicken appears to have one primary functional TRHR form (with some truncated variants), other vertebrates like Xenopus laevis have evolved three distinct TRHR subtypes (xTRHR1, xTRHR2, and xTRHR3) . Phylogenetic analysis revealed that xTRHR1 belongs to subfamily 1, xTRHR2 to subfamily 2, while xTRHR3 represents a novel subtype awaiting discovery in other species .

  • Tissue-Specific Expression Patterns: Different TRHR subtypes in other species show distinct tissue distribution patterns. In Xenopus, xTRHR3 is abundant in the brain and scarcer in peripheral tissues, xTRHR1 is primarily found in the stomach, and xTRHR2 in the heart . Comparing these patterns with chicken TRHR expression could reveal evolutionary shifts in receptor function across vertebrate lineages.

The conservation of TRHR across species that diverged over 300 million years ago highlights the fundamental importance of TRH signaling in vertebrate physiology and provides a valuable model for studying molecular evolution of hormone-receptor systems.

What role does genomic recombination play in the evolution of the chicken TRHR gene?

While the search results don't provide specific information about recombination in the chicken TRHR gene region, general principles of genomic recombination in the chicken genome can be applied to understanding potential recombination patterns affecting this gene:

  • Chromosome-Specific Recombination Rates: Recombination rates in chickens vary considerably among chromosomes as well as along individual chromosomes . The genomic location of TRHR would influence its recombination environment, particularly whether it resides on a macro- or microchromosome.

  • Sequence Composition Influence: Analysis of sequence composition at recombination hot and cold spots in the chicken genome revealed a strong positive correlation between GC-rich sequences and high recombination rates . Specifically:

    Sequence FeatureCorrelation with Recombination Rate
    GC-rich regionsStrong positive correlation
    Cohesin binding sites (CCNCCNGGNGG)3.4-fold higher density at recombination hot spots
    CCTCCCT motifSignificant positive correlation
    AT-rich sequencesNegative correlation
    LINE elementsNegative correlation within macrochromosomes
  • Population Variation: The search results indicate "prominent heterogeneity in recombination rates between populations" in chickens . This suggests that recombination rates in the TRHR region might vary between different chicken breeds or wild populations.

  • Selection Effects: Recombination rates in domestic chicken breeds under strong artificial selection appear to be higher than in wild-type fowl . If TRHR has been under selection pressure related to growth or metabolic traits, this could potentially influence local recombination patterns.

Understanding recombination in the TRHR genomic region would require mapping its precise location and analyzing local sequence features in relation to known recombination hotspots in the chicken genome. Such analysis could provide insights into the evolutionary history of this gene and potential for genetic diversity in receptor variants across chicken populations.

What are the optimal expression systems for studying recombinant chicken TRHR?

Selecting the appropriate expression system is critical for successful functional studies of recombinant chicken TRHR. Based on the search results and established practices in GPCR research, several expression systems offer distinct advantages:

  • Mammalian Cell Lines: HEK-293 cells have been successfully used for expressing TRH receptors from other species . These cells provide appropriate post-translational modifications and contain much of the necessary signaling machinery. For chicken TRHR, consideration should be given to co-expressing relevant G-protein subunits or other signaling components that might be distinct in avian systems.

  • Xenopus Oocytes: This system has proven effective for functional expression of TRHRs, as demonstrated in studies with Xenopus TRHRs . Oocytes provide a robust environment for membrane protein expression and contain minimal endogenous GPCR activity that might interfere with signaling measurements.

  • Avian Cell Lines: Although not specifically mentioned in the search results, chicken-derived cell lines (e.g., DF-1 fibroblasts, LMH hepatocellular carcinoma cells) would provide a more native cellular environment for chicken TRHR studies.

Each system offers trade-offs between technical simplicity, physiological relevance, and available downstream assays:

Expression SystemSignal Detection MethodsAdvantagesLimitations
HEK-293 cellsCalcium imaging, IP accumulation, BRET/FRETWell-established protocols, high transfection efficiencyMay lack avian-specific interacting proteins
Xenopus oocytesTwo-electrode voltage clamp, calcium-activated chloride currentsRobust expression, minimal backgroundLimited throughput, less physiologically relevant
Avian cell linesSimilar to HEK-293 cellsNative cellular environmentPotentially lower transfection efficiency

The search results indicate that pharmacological characterization of chicken TRHR has been successfully performed , suggesting that functional expression was achieved, likely in a mammalian cell system given standard practices in GPCR research.

How can researchers investigate the interaction between TRH and other hypothalamic hormones in regulating TSH secretion?

Investigating the complex interplay between TRH and other hypothalamic hormones in regulating TSH secretion requires integrated experimental approaches spanning multiple levels of analysis. The search results provide important context, noting that TSH secretion in chickens is stimulated by both TRH and corticotropin-releasing hormone (CRH), while somatostatin (SRIH) exerts an inhibitory effect .

Recommended Methodological Approaches:

  • Receptor Co-expression Studies:

    • Co-express chicken TRHR with somatostatin receptors (SSTRs) or CRH receptors in cell systems

    • Measure signaling responses to individual hormones and combinations

    • Investigate potential receptor heterodimerization using BRET/FRET techniques

  • Ex Vivo Pituitary Studies:

    • Isolate chicken pituitary cells or tissue explants

    • Perform perifusion studies with controlled administration of TRH, CRH, and SRIH individually and in combination

    • Measure TSH secretion profiles under various treatment conditions

  • Molecular Characterization of Signaling Interactions:

    • Investigate crosstalk between signaling pathways downstream of TRHR, CRH-R, and SSTRs

    • Examine how activation of inhibitory pathways (e.g., by SRIH) modulates stimulatory pathways (e.g., TRH-induced)

    • Use phosphoproteomics to identify integration points in signaling networks

  • In Vivo Approaches:

    • Develop chicken models with modified expression of specific receptors

    • Use in vivo microdialysis to administer hormones and measure responses

    • Employ modern genetic approaches (e.g., CRISPR) to modify specific receptor genes

The search results indicate that thyrotropes express both TRH-Rs and SSTR2s, allowing direct action of both TRH and SRIH on these cells . In contrast, CRH receptors (CRH-R1) are primarily expressed on corticotropes, suggesting that CRH-stimulated TSH release likely involves indirect mechanisms . One proposed mechanism is that a pro-opiomelanocortin (POMC)-derived peptide, secreted by corticotropes following CRH stimulation, could act as an activator of TSH secretion in a paracrine manner . This hypothesis would require specialized experimental designs to verify.

What techniques are most reliable for measuring chicken TRHR-mediated signal transduction?

Reliably measuring signal transduction mediated by chicken TRHR requires techniques that capture both immediate signaling events and downstream functional consequences. Based on the search results and established GPCR signaling assays, the following approaches are recommended:

Primary Signal Transduction Measurements:

  • Inositol Phosphate Accumulation: Since TRHRs typically couple to the Gq/11 pathway, measuring inositol phosphate production is a direct indicator of receptor activation. This can be done using:

    • Radiolabeled myo-[³H]inositol incorporation

    • ELISA-based IP1 accumulation assays

    • Mass spectrometry-based phosphoinositide profiling

  • Calcium Mobilization: The search results indicate that TRHRs couple to the inositol phosphate/calcium pathway . Real-time calcium measurements can be performed using:

    • Fluorescent calcium indicators (Fluo-4, Fura-2)

    • Genetically encoded calcium indicators (GCaMP variants)

    • FLIPR-based high-throughput calcium assays

  • G-protein Activation Assays:

    • BRET/FRET-based G-protein dissociation assays

    • [³⁵S]GTPγS binding assays

    • G-protein specific biosensors

Downstream Signaling and Functional Readouts:

  • Protein Kinase C Activation:

    • Translocation assays using fluorescently tagged PKC

    • Phosphorylation of PKC substrates

    • PKC activity assays using specific peptide substrates

  • MAP Kinase Cascade Activation:

    • Phospho-specific antibodies for ERK1/2

    • Kinase activity assays

    • Transcriptional reporter assays (e.g., Elk1-driven luciferase)

  • Physiological Responses in Cell Models:

    • TSH secretion from thyrotropic cell lines

    • Gene expression changes using qRT-PCR or RNA-seq

    • Cell proliferation or metabolic responses

When designing these assays, it's important to include positive controls (direct pathway activators) and negative controls (pathway inhibitors) to validate assay performance. Dose-response relationships should be established using a range of TRH concentrations, and temporal dynamics should be characterized to capture both rapid (seconds to minutes) and delayed (hours) responses.

How should researchers analyze contradictory data in chicken TRHR studies?

A particularly valuable approach is to develop structure-function hypotheses that could explain apparently contradictory results. For example, if different studies report varying binding affinities, this might reflect different receptor conformational states stabilized by specific experimental conditions.

The search results highlight that even truncated forms of chicken TRHR can be cloned , suggesting that experimental artifacts from using incomplete or variant receptor forms could contribute to contradictory findings.

What bioinformatic tools are most useful for analyzing chicken TRHR sequence and structure?

Bioinformatic analysis of chicken TRHR sequence and structure requires specialized tools that leverage evolutionary conservation and structural prediction methods. Based on the search results and current bioinformatic practices, the following tools and approaches are recommended:

Sequence Analysis Tools:

  • Multiple Sequence Alignment:

    • MUSCLE or CLUSTAL for aligning chicken TRHR with other species

    • T-COFFEE for integrating structural information into alignments

    • PRALINE for transmembrane protein-specific alignments

  • Evolutionary Analysis:

    • MEGA for phylogenetic tree construction and molecular evolutionary analyses

    • PAML for detecting selective pressure on specific residues

    • ConSurf for mapping conservation onto structural models

  • Transmembrane Topology Prediction:

    • TMHMM or HMMTOP for predicting transmembrane helices

    • TOPCONS for consensus prediction of membrane protein topology

    • SignalP for signal peptide prediction

Structural Analysis Tools:

  • Homology Modeling:

    • MODELLER for generating 3D models based on related GPCR structures

    • SWISS-MODEL for automated homology modeling

    • I-TASSER for integrative approaches to structure prediction

  • Molecular Docking:

    • AutoDock or GOLD for predicting TRH binding to the receptor

    • HADDOCK for protein-protein interaction modeling

    • Schrodinger Suite for more sophisticated ligand-receptor interactions

  • Molecular Dynamics Simulation:

    • GROMACS for simulating receptor dynamics in membranes

    • NAMD for large-scale simulations

    • AMBER for focused refinement of binding interactions

Functional Site Prediction:

  • Binding Site Analysis:

    • SiteMap for identifying potential ligand binding sites

    • CASTp for geometric analysis of protein pockets

    • FTMap for mapping functional hot spots

  • Post-translational Modification Prediction:

    • NetPhos for phosphorylation sites

    • NetOGlyc and NetNGlyc for glycosylation sites

    • GPS for comprehensive PTM prediction

The search results highlight the complete conservation of the ligand binding pocket between chicken and mammalian TRHRs , suggesting that comparative modeling using mammalian TRHR structures would be particularly effective. Additionally, analysis of truncated forms of chicken TRHR mentioned in the search results would benefit from tools that can predict the structural and functional consequences of these truncations.

What are the most promising future research directions for chicken TRHR studies?

The study of chicken TRHR presents several promising avenues for future research that could advance both basic science understanding and potential applications in avian physiology and production. Based on the search results and current trends in receptor biology, the following research directions appear particularly promising:

  • Comprehensive Tissue-Specific Expression Mapping:

    • Develop detailed expression atlases of TRHR across chicken tissues and developmental stages

    • Investigate potential splice variants and their functional significance

    • Compare expression patterns between layer and broiler breeds

  • Advanced Structural Biology Approaches:

    • Pursue cryo-EM or X-ray crystallography studies of chicken TRHR

    • Investigate receptor-ligand complexes to understand binding dynamics

    • Compare structural features with mammalian and other vertebrate TRHRs

  • Receptor Signalosome Characterization:

    • Identify chicken-specific interacting proteins using proteomics

    • Map the complete signaling networks downstream of TRHR activation

    • Investigate potential receptor heterodimers and their functional consequences

  • Genetic Diversity and Selective Breeding Implications:

    • Analyze TRHR genetic variations across chicken breeds and correlate with productive traits

    • Assess whether selective breeding has influenced TRHR function

    • Develop genetic markers for TRHR variants that might predict growth or metabolic properties

  • Integration with Broader Neuroendocrine Regulation:

    • Further investigate the paracrine interactions suggested in the search results

    • Explore potential novel CRH receptor subtypes that might directly regulate TSH secretion

    • Develop systems biology models of hypothalamic-pituitary-thyroid axis regulation

  • Technological Applications:

    • Develop TRHR-targeted compounds for potential modulation of growth or metabolism

    • Explore applications in broiler production through targeted nutrition or genetic approaches

    • Investigate potential relationships between TRHR function and stress resilience in commercial poultry

The search results indicate several knowledge gaps that future research could address, including the mechanisms of CRH-induced TSH secretion, which might involve "a yet unknown type of CRH-R in the chicken" or paracrine effects mediated by POMC-derived peptides . Additionally, the functional significance of the truncated TRHR forms identified in chickens remains to be fully elucidated.

How might chicken TRHR research inform broader comparative endocrinology studies?

Chicken TRHR research offers valuable insights that can significantly advance comparative endocrinology across vertebrate species. The strategic position of birds in vertebrate evolution makes them particularly informative for understanding the evolution of neuroendocrine systems.

Key Contributions to Comparative Endocrinology:

  • Evolutionary Conservation and Divergence:

    • The remarkably conserved ligand binding pocket between chicken and mammalian TRHRs provides evidence for fundamental mechanisms preserved across 310+ million years of evolution

    • Comparing chicken TRHR with the three distinct subtypes in Xenopus illuminates receptor diversification patterns across vertebrate lineages

    • The search results indicate "considerable evolutionary constraints on TRHR structure and function" , offering insights into essential vs. adaptable features of neuroendocrine receptors

  • Receptor-Hormone Co-evolution:

    • Chicken studies can reveal how TRH and its receptor have co-evolved while maintaining functional interaction

    • The conservation of binding properties despite sequence divergence highlights critical residues for hormone recognition

  • Hypothalamic-Pituitary Axis Organization:

    • The search results describe how thyrotropes express both TRH-Rs and SSTR2s, allowing direct hormonal regulation

    • Chicken-specific mechanisms, such as the proposed paracrine regulation involving POMC-derived peptides , provide comparative insights into hypothalamic-pituitary communication strategies

  • Methodological Advances:

    • Techniques developed for chicken TRHR studies can be applied across species

    • Comparative pharmacological approaches using TRH analogs across species help identify universal vs. species-specific ligand recognition mechanisms

  • Integrative Physiology Perspectives:

    • Understanding how chicken TRHR regulates metabolism, growth, and development provides comparative insights into fundamental vertebrate physiological mechanisms

    • The potential roles of TRH in avian growth compared to its functions in other vertebrates illuminate evolutionary adaptations of hypothalamic regulation

The search results highlight that chicken TRHR was the first TRHR cloned from a non-mammalian vertebrate class , underscoring its importance as a pivotal model in bridging our understanding between mammalian and non-mammalian vertebrate neuroendocrine systems.

What are common technical challenges in recombinant chicken TRHR expression and how can they be overcome?

Expressing recombinant chicken TRHR presents several technical challenges that researchers must address to obtain reliable experimental systems. While the search results don't explicitly discuss technical difficulties, common challenges in GPCR expression can be applied to chicken TRHR research:

Challenge 1: Low Expression Levels

  • Problem: GPCRs often express poorly in heterologous systems due to misfolding or degradation.

  • Solutions:

    • Use codon-optimized sequences for the expression system

    • Include N-terminal signal sequences to enhance membrane targeting

    • Add affinity tags (e.g., FLAG, His) for detection and purification

    • Consider fusion proteins (e.g., T4 lysozyme) to improve stability

    • Use specialized expression vectors with strong promoters for avian proteins

Challenge 2: Receptor Misfolding

  • Problem: Incorrect folding leads to receptor retention in the endoplasmic reticulum.

  • Solutions:

    • Culture cells at lower temperatures (30-32°C) to slow folding and allow proper maturation

    • Add pharmacological chaperones during expression

    • Include glycosylation sites if not naturally present

    • Screen multiple cell lines for optimal folding environments

Challenge 3: Truncated Receptor Forms

  • Problem: The search results mention truncated forms of chicken TRHR that retain part of an intron and are truncated in the putative third intracellular loop .

  • Solutions:

    • Carefully verify cDNA sequences before expression

    • Use high-fidelity reverse transcription to minimize artifacts

    • Consider native chicken cell lines that may process transcripts correctly

    • Design constructs with intron-free coding sequences

Challenge 4: Functional Characterization Difficulties

  • Problem: Assay systems optimized for mammalian receptors may not be optimal for chicken TRHR.

  • Solutions:

    • Adapt assay parameters (buffer compositions, temperatures, incubation times)

    • Include positive controls (e.g., well-characterized mammalian TRHR)

    • Use multiple complementary assays to verify functional activity

    • Consider species-specific G-proteins or signaling components as co-expression partners

Practical Implementation Table:

ChallengeDiagnostic ApproachOptimization StrategyValidation Method
Low surface expressionFlow cytometry or immunofluorescenceTest multiple N-terminal tags and signal sequencesWestern blot of membrane fractions
Poor functional responseDose-response curves with known ligandsAdjust assay conditions and co-express G-proteinsCompare EC50 values with literature data
Truncated productsSDS-PAGE and Western blotUse codon-optimized synthetic genesMass spectrometry of purified protein
Unstable receptorStability assays at different temperaturesAdd stabilizing mutations or fusion partnersLong-term activity retention measurement

The search results indicate successful expression and pharmacological characterization of chicken TRHR , suggesting that these challenges can be overcome with appropriate experimental design.

How can researchers effectively validate antibodies and other tools for chicken TRHR research?

Effective validation of antibodies and other research tools is critical for reliable chicken TRHR studies. Based on general principles of research tool validation and considerations specific to GPCRs, the following comprehensive approach is recommended:

Antibody Validation Strategy:

  • Specificity Verification:

    • Test antibodies on cells/tissues with confirmed TRHR expression versus negative controls

    • Perform Western blots on recombinant chicken TRHR versus lysates from untransfected cells

    • Use multiple antibodies targeting different epitopes and compare results

    • Implement knockdown/knockout controls where feasible (e.g., siRNA in cell culture)

  • Cross-Reactivity Assessment:

    • Evaluate potential cross-reactivity with related GPCRs

    • Test specificity across species (particularly important given the high conservation noted in the search results )

    • Perform peptide competition assays to confirm epitope specificity

  • Application-Specific Validation:

    • For immunohistochemistry: include appropriate blocking controls and validate fixation protocols

    • For immunoprecipitation: confirm pull-down of full-length protein by mass spectrometry

    • For flow cytometry: validate using cells expressing varying levels of the receptor

Other Research Tools Validation:

  • TRH Analogs and Ligands:

    • Verify purity by HPLC and mass spectrometry

    • Confirm biological activity in established systems

    • Characterize pharmacokinetic properties for in vivo use

    • Determine selectivity against other related receptors

  • Expression Constructs:

    • Sequence verify the entire construct

    • Confirm expression by multiple methods (mRNA, protein)

    • Validate functional coupling to downstream pathways

    • Check for potential fusion tag interference with receptor function

  • Cell Lines and Primary Cultures:

    • Authenticate cell lines using STR profiling

    • Regularly test for mycoplasma contamination

    • Verify consistent receptor expression levels across passages

    • Characterize endogenous expression of relevant signaling components

Validation Documentation Table:

Validation ParameterAcceptance CriteriaDocumentation Method
Antibody specificitySingle band at expected MW, absent in negative controlsWestern blot images with molecular weight markers
Functional couplingDose-dependent response to TRHEC50 values with confidence intervals
Expression construct fidelity100% sequence match to referenceSequencing chromatograms and alignment
Cell line authenticationMatch to reference profileSTR profiling report

The search results don't specifically address validation methods for chicken TRHR tools, but the detailed characterization of chicken TRHR would require properly validated reagents and research tools. The high conservation of chicken TRHR compared to mammalian receptors suggests that some mammalian-targeted tools might work for chicken studies, but careful validation would still be essential.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.