Recombinant Chicken Translocation protein SEC62 (SEC62)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is requested. Advance notice and additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us; we will prioritize its use.
Synonyms
SEC62; TLOC1; RCJMB04_25p9; Translocation protein SEC62; Translocation protein 1; TP-1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-398
Protein Length
full length protein
Species
Gallus gallus (Chicken)
Target Names
Target Protein Sequence
MAERRRHRKRIQEVGEPFKEEKAVAKYLRFNCPTKSTNMMGHRVDYFIASKAVDCLLDSK WAKAKKGEEALFTTRESVVDYCNRLLKKQFFHRALKVMKMKPDKDTKKEKEKGKAESGKE EEKKSKKESSKDEKTKKEKEKKKDGEKEECKKDETPGTPKKKETKRKFKLEPHEDQVFLD GNEVYVWIYDPVHFKTFAMGLVLVIAVIAATLFPLWPAEMRVGVYYLSVGAGCFVASILL LAVARCILFLIIWLITGGRHHFWFLPNLTADVGFIDSFRPLYTHEYKGPKADLKKEEKSE SKKQQKYDSEEKSDSEKKEEEDGKTEATRNSGTEGSGGERHSDTDSDRREDDRSQHSSGN GNDFEMITKEELEQQTDEGDCEEDEDEDTESRPSHEKS
Uniprot No.

Target Background

Function
Essential for preprotein translocation.
Database Links
Protein Families
SEC62 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Chicken SEC62 and what are its fundamental characteristics?

Recombinant Chicken SEC62 is a full-length or partial-length protein expressed in mammalian cells that functions as an essential component of the post-translational protein translocation machinery in the endoplasmic reticulum . The protein is encoded by the SEC62 gene (Gene ID: 424993) in Gallus gallus (chicken) and has the UniProt ID Q5F3A1 .

SEC62 is primarily characterized as an ER membrane-associated protein that mediates the insertion and orientation of moderately hydrophobic signal anchor proteins in the ER membrane . It specifically mediates membrane proteins' insertion in the N in-C out membrane orientation, playing a critical role in regulating membrane topogenesis . The protein is typically produced with a His-tag and is available in either liquid or lyophilized form with >80% purity .

What are the primary functions of SEC62 in cellular processes?

SEC62 exhibits dual functionality in cellular processes:

  • Protein Translocation: SEC62 serves as an essential component of the post-translational translocation machinery in the ER, particularly for moderately hydrophobic signal anchor proteins . Studies using yeast mutant strains have demonstrated that defects in SEC62 selectively reduce the insertion of signal sequences in the ER membrane .

  • ER Stress Regulation and Autophagy: SEC62 functions as an ER-phagy receptor with ER-resident LC3-interacting regions (LIR) that promote the delivery of select ER domains to autolysosomes for degradation . This function is particularly important during recovery from ER stress, as SEC62 helps re-establish pre-stress ER homeostasis . Notably, the roles of SEC62 in protein translocation and in removing excess ER during stress recovery can be experimentally separated .

How does SEC62 expression change during cellular stress conditions?

SEC62 expression exhibits dynamic changes during cellular stress, particularly in response to viral infection. Research on foot-and-mouth disease virus (FMDV) infection has shown that SEC62 is slightly increased at the early stages of infection but dramatically decreases in later stages . This temporal regulation appears to be part of the virus's strategy to modulate host cell responses.

During recovery from ER stress, SEC62 plays a vital role in delivering excess ER proteins to autolysosomes for clearance. Silencing or knockout of SEC62 inhibits the delivery of ER protein markers to autolysosomes during recovery from ER stress . The contribution of SEC62 to ER stress recovery is independent of its role in protein translocation, as demonstrated by complementation experiments with a SEC62 mutant lacking the LC3-interacting region (LIRmut) .

What are the recommended storage and handling conditions for recombinant chicken SEC62?

For optimal integrity and activity of recombinant chicken SEC62, the following storage and handling protocols are recommended:

  • Short-term storage: Store at +4°C in PBS buffer .

  • Long-term storage: Store at -20°C to -80°C in PBS buffer .

  • Endotoxin levels: The preparation should contain less than 1.0 EU per μg of protein as determined by the LAL method .

  • Purity considerations: Standard preparations have >80% purity and researchers should verify this via appropriate analytical methods before experimental use .

For experiments requiring custom specifications, custom production is available with a typical lead time of 5-9 weeks . This may be particularly important for studies requiring specific tags, formulations, or higher purity levels.

How can researchers distinguish between SEC62's roles in protein translocation versus ER stress recovery?

Researchers can experimentally separate SEC62's functions in protein translocation and ER stress recovery using the following methodological approaches:

  • Mutational analysis: The LC3-interacting region (LIR) mutant of SEC62 (SEC62LIRmut) is crucial for this distinction. While this mutant is inactive in ER stress recovery, it remains equally effective as wild-type SEC62 in protein translocation functions . Complementation experiments in SEC62 knockout cells have demonstrated that SEC62LIRmut can restore protein translocation but not autophagy-mediated ER stress recovery .

  • Translocation assays: Researchers can assess protein translocation efficiency using model substrates like ERj3. In SEC62 knockout (CRISPR62) cells, ERj3 translocation is compromised but can be restored by expressing either wild-type SEC62 or SEC62LIRmut .

  • Autophagosome-lysosome fusion analysis: Immunofluorescence microscopy with markers such as LAMP1 (lysosomal marker) and calnexin (Cnx, ER marker) can be used to track the formation of autolysosomes containing ER components. In cells lacking functional SEC62 or expressing SEC62LIRmut, LAMP1-positive vesicles do not contain ER markers during recovery from ER stress .

What techniques are effective for studying SEC62-mediated autophagy in experimental models?

Several complementary techniques have proven effective for investigating SEC62's role in autophagy:

  • Isopycnic density gradient fractionation: This technique separates autolysosomal vesicles (AV) from other cellular components. In these gradients, AV protein markers such as LC3-II and p62/Sequestosome float from the loading region to the lightest fractions . Comparing fractions from cells expressing wild-type SEC62 versus SEC62LIRmut can identify proteins specifically cleared through SEC62-mediated autophagy.

  • Mass spectrometry with label-free quantification (MS-LFQ): This approach identifies proteins depleted from AV fractions in cells expressing SEC62LIRmut compared to wild-type SEC62, revealing potential SEC62-dependent autophagy substrates. PDI family members have been identified as examples of such substrates .

  • Immunofluorescence microscopy: Co-localization studies tracking SEC62, LC3 (autophagosome marker), and ER markers can visualize the recruitment of autophagosomes to ER domains. The formation of puncta containing both SEC62 and ER markers that accumulate upon lysosomal inactivation (e.g., with Bafilomycin A1) indicates active SEC62-mediated ER-phagy .

How does SEC62 regulate the IRE1α signaling pathway during stress responses?

SEC62 exhibits sophisticated regulation of the IRE1α pathway, particularly during stress responses:

The experimental evidence suggests that SEC62 serves as a molecular switch integrating ER stress signals with autophagy responses, making it a potential therapeutic target for conditions involving ER stress dysregulation.

What is the significance of SEC62 in cancer research and potential therapeutic applications?

SEC62 has emerged as a significant factor in cancer research with potential diagnostic and therapeutic implications:

  • Overexpression in cancer progression: Multiple studies have identified SEC62 overexpression as a phenomenon associated with cancer progression, particularly in prostate cancer, non-small cell lung cancer (NSCLC), and thyroid cancer . This overexpression correlates with two hallmarks of cancer: increased stress tolerance and enhanced migratory and invasive potential .

  • Diagnostic marker potential: Due to its consistent overexpression pattern in certain cancer types, SEC62 has been suggested as a potential diagnostic marker, especially in prostate cancer . The correlation between SEC62 expression levels and cancer progression offers possibilities for developing diagnostic tests based on SEC62 detection.

  • Therapeutic target considerations: The association of SEC62 overexpression with increased ER stress tolerance in cancer cells suggests its potential as a therapeutic target . Inhibiting SEC62 function could potentially reduce cancer cell survival under stress conditions and limit their migratory and invasive capabilities, thereby addressing two key mechanisms of cancer progression.

Research models examining SEC62 inhibition or downregulation in cancer cell lines could provide valuable insights into potential therapeutic strategies targeting this protein.

How does SEC62 contribute to membrane protein topogenesis and what are the implications for membrane protein research?

SEC62 plays a crucial role in determining the correct orientation and insertion of membrane proteins, particularly those with moderately hydrophobic signal anchor sequences:

  • Hydrophobicity-dependent targeting: Research using yeast mutant strains defective in SEC62 function has revealed that SEC62 mediates membrane insertion and proper orientation of signal anchor proteins in an N in-C out membrane topology . This function is particularly important for moderately hydrophobic signal anchor proteins that may not be efficiently targeted by the signal recognition particle (SRP) pathway alone.

  • Dual pathway cooperation: The experimental evidence suggests that SRP-dependent co-translational and SRP-independent post-translational translocation pathways are not mutually exclusive for signal anchor proteins . Moderately hydrophobic signal anchor proteins require both SRP and SEC62 for proper targeting and translocation to the ER . This finding challenges the traditional binary view of protein translocation pathways.

  • Experimental implications: For researchers studying membrane protein insertion and topology, these findings highlight the importance of considering SEC62 as a critical factor in experimental design. Studies involving membrane proteins with moderate signal sequence hydrophobicity should account for potential SEC62 dependency, especially when interpreting results from systems with altered SEC62 expression or function.

The role of SEC62 in membrane protein topogenesis expands our understanding of the factors governing membrane protein assembly and provides new avenues for manipulating membrane protein expression in both basic research and biotechnological applications.

What are common challenges in SEC62 functional studies and how can they be addressed?

Researchers investigating SEC62 function frequently encounter several challenges that can affect experimental outcomes:

  • Functional redundancy: SEC62 operates within a complex network of protein translocation and ER stress response factors. This functional overlap can mask phenotypes in single-gene perturbation experiments.

    • Solution: Consider using combinatorial approaches where multiple components are perturbed simultaneously or employ acute depletion strategies like the auxin-inducible degron system to avoid compensatory mechanisms.

  • Distinguishing pathway-specific effects: SEC62 participates in both protein translocation and ER-phagy, making it difficult to attribute phenotypes to specific pathways.

    • Solution: Utilize the SEC62LIRmut variant that selectively lacks ER-phagy function while maintaining translocation activity . This approach allows researchers to separate the two functional roles experimentally.

  • Temporal dynamics: SEC62 expression and function change dynamically during stress responses, with different effects at early versus late stages of stress.

    • Solution: Implement time-course experiments with appropriate temporal resolution and consider using inducible expression systems to control SEC62 levels at specific experimental timepoints.

How should researchers interpret conflicting data regarding SEC62 function across different experimental systems?

When faced with conflicting data about SEC62 function, consider these analytical approaches:

What experimental controls are essential when studying SEC62-mediated processes?

Robust SEC62 research requires several critical controls:

  • Expression level verification:

    • Western blot analysis to confirm successful overexpression, knockdown, or knockout of SEC62

    • Quantification relative to housekeeping proteins to ensure consistency across experimental conditions

    • Comparison to endogenous expression levels to avoid artifacts from non-physiological expression

  • Functional complementation controls:

    • Include both wild-type SEC62 and SEC62LIRmut when studying ER-phagy functions

    • Verify translocation functionality using established substrates like ERj3

    • Include domain-specific mutants to map functional regions

  • Pathway-specific markers:

    • For translocation studies: include positive controls known to depend exclusively on SEC62

    • For ER-phagy: include lysosomal inhibitors (e.g., Bafilomycin A1) to confirm proper vesicle formation and flux

    • For stress response: validate both upstream (e.g., IRE1α phosphorylation) and downstream (e.g., JNK activation) pathway components

What emerging techniques might advance our understanding of SEC62 function?

Several cutting-edge technologies show promise for deepening our understanding of SEC62 biology:

  • Cryo-electron microscopy (Cryo-EM): High-resolution structural studies of SEC62 in complex with the translocation machinery could reveal mechanistic details of how SEC62 facilitates protein insertion and how this activity is regulated. Particularly valuable would be transitional states during substrate handling.

  • Proximity-based proteomics: Techniques like BioID or APEX2 proximity labeling could identify the dynamic interactome of SEC62 under different cellular conditions, revealing context-specific interaction partners during normal homeostasis versus stress conditions.

  • Single-cell analysis technologies: Examining SEC62 expression and function at the single-cell level could reveal cell-to-cell variability in SEC62-dependent processes and uncover potential heterogeneity in response to stressors or therapeutic interventions.

  • In vivo imaging of SEC62 dynamics: Developing tools for real-time visualization of SEC62 activity, such as split fluorescent protein systems or FRET-based sensors, could track SEC62 recruitment to different cellular domains during stress responses.

What are the key unresolved questions regarding SEC62 function that require further investigation?

Despite significant advances, several fundamental questions about SEC62 remain unanswered:

  • Regulatory mechanisms: How is SEC62 function switched between its roles in protein translocation versus ER-phagy? Are post-translational modifications involved in this functional transition?

  • Substrate specificity: What determines which ER domains are selected for SEC62-mediated autophagy? Is there selectivity for specific ER proteins or lipid compositions?

  • Therapeutic potential: Can SEC62 be specifically targeted pharmacologically to modulate either its translocation or autophagy functions? This question is particularly relevant for cancer applications where SEC62 overexpression promotes stress tolerance .

  • Evolutionary conservation: How conserved are SEC62's dual functions across species? While its role in translocation appears broadly conserved, is the ER-phagy function equally preserved?

  • Physiological significance: What is the importance of SEC62-mediated ER-phagy in whole organism physiology and in response to physiological stressors beyond experimental cell culture systems?

How might SEC62 research impact broader fields of cell biology and disease research?

SEC62 research has the potential to influence multiple research domains:

  • Protein quality control: Understanding SEC62's role in managing ER stress could provide insights into fundamental mechanisms of protein quality control and proteostasis maintenance, with implications for neurodegenerative diseases characterized by protein misfolding.

  • Cancer biology: The association between SEC62 overexpression and cancer progression offers opportunities for new diagnostic approaches and potential therapeutic targets . Further characterization of how SEC62 promotes cancer cell survival under stress conditions could reveal vulnerabilities for therapeutic exploitation.

  • Viral pathogenesis: SEC62's role in antiviral responses, particularly through the IRE1α-JNK pathway, highlights potential targets for antiviral strategies . Understanding how viruses like FMDV downregulate SEC62 could inform broad-spectrum antiviral approaches.

  • Cellular stress adaptation: SEC62's function in maintaining ER homeostasis during stress recovery represents a model system for studying cellular adaptation mechanisms, with potential applications to understanding cellular resilience in various physiological and pathological contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.