Recombinant Chicken Transmembrane anterior posterior transformation protein 1 homolog (TAPT1)

Shipped with Ice Packs
In Stock

Description

Gene Structure and Evolutionary Context

The chicken TAPT1 gene differs significantly from mammalian orthologs, particularly in exon organization and protein domains. Key structural features include:

  • Truncated exon 1: Chicken TAPT1 lacks ~150 amino acids present in human TAP1, potentially altering endoplasmic reticulum retention and heterodimer formation .

  • Fused exons: Chicken TAPT2 (a related gene) exhibits fused exons, reducing gene size compared to human counterparts .

  • High polymorphism: Chicken TAPT1 alleles are as numerous as class I major histocompatibility complex (MHC) alleles, suggesting co-evolution with immune-related genes .

FeatureChicken TAPT1Human TAP1
Exon 1TruncatedFull-length
ER retention domainAbsentPresent
PolymorphismHighModerate
ATP-binding motifsConserved (with exceptions)Conserved

Table 1: Structural differences between chicken and human TAPT1/TAP1 .

Protein Structure and Topology

Recombinant Chicken TAPT1 (UniProt ID: Q5ZLG8) spans 581 amino acids (1-581aa) and contains:

  • Eight transmembrane helices: Predicted via MEMSAT-SVM modeling, with both N- and C-termini localized extracellularly .

  • 27 helices and 32 beta-turns: Secondary structure analysis reveals a complex fold with a single disulfide bond .

  • Pore-forming residues: Critical amino acids (H235, R323, K443, N446, S447, L450, K453, S454, Y457, K511, N513, D533, K535, D536, T538) line the transport channel, forming a diamond-shaped pore .

Amino Acid Sequence Highlights (partial):
MAGVSDAAAPGSGGEGRRGGGGSPEQLQQDGCRGEPKTLWGSSELRPPPAGPGQPSPHQR...
Full sequence available in Source .

Functional Insights and Transport Mechanisms

TAPT1 is hypothesized to function as a transporter or signaling molecule:

  • Flavonoid transport: Molecular docking predicts flavonoids (e.g., glycosides) as substrates, interacting with pore-lining residues (e.g., H235, R323) .

  • Ciliary and mitochondrial localization: TAPT1 may localize to primary cilia and mitochondrial membranes, influencing intracellular trafficking and viral entry .

  • HOXC8 interaction: Functional partners include HOXC8, a homeobox protein critical for anterior-posterior patterning .

ResidueRole in Pore FormationFunctional Impact
H235Pore surface/substrate bindingFlavonoid recognition
R323Electrostatic interactionsSubstrate translocation
K443Charge-based gatingTransport efficiency

Table 2: Key residues in TAPT1’s transport pore .

Production and Characterization

Recombinant Chicken TAPT1 is produced via bacterial expression:

ParameterSpecification
Expression SystemE. coli
TagN-terminal His-tag
Purity>90% (SDS-PAGE)
Storage BufferTris/PBS-based, 6% trehalose, pH 8.0
ReconstitutionDeionized water (0.1–1.0 mg/mL)

Table 3: Production characteristics of recombinant Chicken TAPT1 .

Stability Notes:

  • Avoid repeated freeze-thaw cycles; store at -20°C/-80°C .

  • Reconstitute with glycerol (5–50%) for long-term storage .

Localization and Interaction Networks

TAPT1 interacts with proteins involved in:

  • Ciliogenesis: Basal ciliary body localization .

  • Bone development: SUCO (SUN domain-containing ossification factor) and SPP2 (secreted phosphoprotein 24) .

  • Chromatin regulation: SMC3 (cohesin complex) and HAUS3 (centrosome integrity) .

Partner ProteinFunctionInteraction Score
HOXC8Anterior-posterior patterning0.811
CSTF1mRNA 3'-end processing0.808
SUCOCollagen synthesis regulation0.686

Table 4: Predicted interaction partners of TAPT1 .

Research Applications and Disease Associations

While primarily studied in avian systems, TAPT1 research informs:

  • Developmental biology: Role in neural crest differentiation and skeletal patterning .

  • Disease modeling: Mutations in human TAPT1 are linked to osteogenesis imperfecta (OI) and neonatal progeria, highlighting conserved ECM-signaling pathways .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
TAPT1; RCJMB04_6d24; Transmembrane anterior posterior transformation protein 1 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-581
Protein Length
full length protein
Species
Gallus gallus (Chicken)
Target Names
Target Protein Sequence
MAGVSDAAAPGSGGEGRRGGGGSPEQLQQDGCRGEPKTLWGSSELRPPPAGPGQPSPHQR TETLGFYESDRGRKKKRGLSDLSLLRFISAELTRGYFLEHNEAKYTERRERVYTCMRIPK ELEKLMFFGIFLCLDAFLYIFTLLPLRVFLAMFRFITLPCYGLRDRRLLQPAQVCDILKG VILVICYFMMHYVDYSMMYHLIRGQSVIKLYIIYNMLEVADRLFSSFGQDILDALYWTAT EPKERKRAHIGVIPHFFMAVLYVFLHAILIMVQATTLNVAFNSHNKSLLTIMMSNNFVEI KGSVFKKFEKNNLFQMSNSDIKERFTNYVLLLIVCLRNMEQFSWNPDHLWVLFPDVCMVV ASEIAVDIVKHAFITKFNDITADVYSEYRASLAFDLVSSRQKNAYTDYSDSVSRRMGFIP LPLAVLLMRVVTSSIKVQGVLAYVCVVLFYCGLISLKVLNSIVLLGKSCQYVKEAKMEEK LFNPVPSASAGKPAGKPQSMFKSTHGFSTDENGSTSVTNQPVHQKDSPPSLLVTSNSDQF LTTPDGEEKDISQDSSELKHRSSKKDLLEIDRFTICGNRID
Uniprot No.

Target Background

Function
TAPT1 plays a role in primary cilia formation. It may act as a downstream effector of HOXC8 during development. TAPT1 may be involved in cartilage and bone development and could play a role in the differentiation of cranial neural crest cells.
Database Links
Protein Families
TAPT1 family
Subcellular Location
Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Cytoplasm, cytoskeleton, cilium basal body. Membrane; Multi-pass membrane protein.

Q&A

What is TAPT1 and what are its known functions?

TAPT1 is a transmembrane protein initially identified through an ENU-induced mutation (L5Jcs1) in mice that caused posterior-to-anterior transformations of the vertebral column, similar to deficiencies in Hoxc8 and Hoxc9 . TAPT1 contains several transmembrane domains and is highly conserved across species from vertebrates to yeast . The protein's functions include:

  • Regulation of axial skeletal patterning during development

  • Involvement in ciliogenesis and ciliary function

  • Potential role in Golgi morphology and trafficking

  • Possible involvement in cellular signaling pathways

Current evidence suggests TAPT1 may act as a downstream effector of HOXC8, potentially transducing or transmitting extracellular information necessary for proper skeletal development .

Where is TAPT1 typically localized in cells?

Wild-type TAPT1 primarily localizes to the centrosome and/or ciliary basal body . Subcellular fractionation studies have shown that endogenous TAPT1 is predominantly enriched in the mitochondria/endoplasmic reticulum/Golgi fractions, with lesser presence in nuclear fractions . Defective TAPT1 can mislocalize to the cytoplasm, disrupting normal Golgi morphology and trafficking as well as primary cilium formation .

It's worth noting that contradicting results have been reported regarding TAPT1 localization, with some studies suggesting ER localization while others indicate centrosomal localization . Researchers studying chicken TAPT1 should verify its localization in avian cells through subcellular fractionation or immunofluorescence with validated antibodies.

What phenotypes result from TAPT1 mutations in various model organisms?

TAPT1 mutations produce significant phenotypic effects across different model organisms:

Model OrganismMutation/ModificationObserved Phenotypes
MouseL5Jcs1 ENU-induced mutationPosterior-to-anterior vertebral transformations, perinatal lethality
HumanDeep intronic variantProgeroid syndrome, protein-null allele
HumanVarious mutationsComplex congenital syndrome with skeletal dysplasia and ciliopathy features, severe hypomineralization, developmental anomalies
Zebrafishtapt1b knockdownSevere craniofacial cartilage malformations, delayed ossification, aberrant differentiation of cranial neural crest cells

These phenotypes demonstrate TAPT1's critical role in skeletal development, with potential implications for understanding the function of chicken TAPT1 homolog in avian skeletal formation and patterning.

How is TAPT1 gene expression regulated?

The TAPT1 gene is situated head-to-head with its sequence-related antisense gene TAPT1-AS1, which encodes a long non-coding RNA . Despite this proximity, experimental evidence suggests that TAPT1-AS1 does not significantly regulate TAPT1 expression:

  • Knockdown of TAPT1-AS1 using GapmeRs did not significantly alter TAPT1 mRNA levels

  • TAPT1 protein expression remained unaffected in TAPT1-AS1 knocked down conditions

  • Downregulation of TAPT1 did not affect expression levels of TAPT1-AS1

This indicates that while many long non-coding RNA:mRNA gene pairs show coordinated expression through shared regulatory elements, TAPT1 regulation appears independent of its antisense transcript.

What approaches are recommended for expressing and purifying recombinant chicken TAPT1?

Expressing and purifying recombinant transmembrane proteins like chicken TAPT1 presents significant challenges. Based on research with mammalian TAPT1, the following approaches are recommended:

  • Expression System Selection:

    • Mammalian cell lines (HEK293 or CHO) offer proper post-translational modifications and membrane insertion

    • Baculovirus-insect cell systems provide higher protein yields while maintaining eukaryotic processing

    • Avoid bacterial expression systems as they typically fail with complex transmembrane proteins

  • Construct Design:

    • Include a cleavable purification tag (His6 or FLAG)

    • Consider expressing individual domains separately if full-length expression proves challenging

    • Incorporate a fluorescent protein tag for localization studies

  • Solubilization and Purification:

    • Use mild detergents (DDM, LMNG) for membrane extraction

    • Employ affinity chromatography followed by size exclusion

    • Consider nanodiscs or amphipols for maintaining native conformation

For functional studies, researchers should validate that recombinant chicken TAPT1 localizes correctly to the centrosome/basal body, as mislocalization is linked to protein dysfunction .

How can one accurately assess the impact of TAPT1 mutations on ciliogenesis?

Given TAPT1's established role in ciliogenesis and ciliary function, assessing the impact of mutations requires multi-faceted approaches:

  • Immunofluorescence Analysis:

    • Serum-starve cells for 24-48 hours to induce ciliogenesis

    • Stain for acetylated tubulin (ciliary axoneme marker) and γ-tubulin (basal body marker)

    • Quantify percentage of ciliated cells and ciliary length

  • Ultrastructural Analysis:

    • Employ transmission electron microscopy to examine ciliary ultrastructure

    • Assess basal body docking and ciliary membrane integrity

  • Functional Assays:

    • Hedgehog signaling responsiveness (Gli reporter assays)

    • Ciliary protein trafficking (using fluorescently tagged ciliary proteins)

    • Calcium imaging to assess ciliary calcium signaling

When analyzing chicken TAPT1, researchers should note that previous knockdown studies of TAPT1 showed a significant reduction in the percentage of ciliated cells and disrupted Golgi morphology . Quantification should include measurements of both the proportion of ciliated cells and cilium morphology parameters.

What methodologies are available for investigating TAPT1's role in skeletal development using chicken models?

Chicken embryos provide an excellent model for studying skeletal development due to their accessibility for manipulation. Several approaches are particularly valuable for investigating TAPT1 function:

  • In Ovo Electroporation:

    • Target neural crest cells or somites with TAPT1 overexpression or knockdown constructs

    • Evaluate effects on skeletal patterning and neural crest cell migration

    • Assess HOX gene expression patterns following TAPT1 manipulation

  • Ex Ovo Culturing and Skeletal Analysis:

    • Alcian blue (cartilage) and Alizarin red (bone) staining to visualize skeletal elements

    • High-resolution micro-CT scanning for detailed 3D skeletal analysis

    • Histological sections to examine growth plate organization

  • Neural Crest Cell Tracking:

    • DiI labeling combined with TAPT1 manipulation

    • Time-lapse imaging of neural crest cell migration and differentiation

    • Analysis of neural crest cell fate following TAPT1 knockdown

These approaches would help determine if chicken TAPT1, like its zebrafish homolog tapt1b, plays a role in cranial neural crest cell differentiation and subsequent craniofacial skeleton development .

How do mutations in TAPT1 affect Golgi morphology and intracellular trafficking?

TAPT1 mutations have been shown to disrupt Golgi morphology and protein trafficking. To investigate these effects in chicken cells, consider the following methodologies:

  • Golgi Morphology Analysis:

    • Immunostaining for Golgi markers (GM130, TGN46)

    • Quantify Golgi fragmentation, positioning, and size

    • Super-resolution microscopy to examine Golgi architecture

  • Protein Trafficking Assays:

    • Vesicular Stomatitis Virus G protein (VSVG) trafficking assays

    • Fluorescence Recovery After Photobleaching (FRAP) to measure membrane protein mobility

    • Secretion assays using reporter proteins

  • Calcium Dynamics:

    • Measure Golgi calcium concentrations using targeted calcium sensors

    • Assess impact on calcium-dependent trafficking events

Defective TAPT1 has been demonstrated to disrupt normal Golgi morphology in human cells , suggesting chicken TAPT1 may play similar roles in maintaining Golgi integrity and function in avian cells.

What genetic manipulation approaches are most effective for studying TAPT1 function in chicken cells?

Several genetic approaches can be employed to study chicken TAPT1 function:

  • CRISPR/Cas9 Genome Editing:

    • Design guide RNAs targeting conserved TAPT1 domains

    • Generate knockout or knock-in chicken cell lines

    • Create point mutations mimicking human disease variants

  • RNAi-Based Knockdown:

    • Design shRNAs or siRNAs targeting chicken TAPT1

    • Validate knockdown efficiency by qRT-PCR and Western blot

    • Assess phenotypic effects on ciliogenesis and Golgi morphology

  • Rescue Experiments:

    • Complement knockouts with wild-type or mutant TAPT1 variants

    • Use species-specific mutations to assess evolutionary conservation of function

    • Express truncated TAPT1 constructs to map functional domains

When designing knockdown experiments, researchers should aim for at least 70-80% reduction in TAPT1 expression, as similar knockdown efficiencies in human cells (84.45%) have successfully revealed functional impacts .

How can one validate antibodies for studying chicken TAPT1 expression and localization?

Proper antibody validation is critical for accurate TAPT1 research. For chicken TAPT1 studies, follow these validation steps:

  • Western Blot Validation:

    • Test antibodies in wild-type and TAPT1-knockdown/knockout samples

    • Include positive controls from mammalian cells expressing chicken TAPT1

    • Verify specificity by comparing to predicted molecular weight

  • Immunofluorescence Validation:

    • Compare staining patterns between wild-type and TAPT1-deficient cells

    • Perform peptide competition assays to confirm specificity

    • Co-localize with known markers (centrosome, Golgi, basal body)

  • Cross-Reactivity Testing:

    • Assess antibody recognition of recombinant chicken TAPT1 versus mammalian TAPT1

    • Perform epitope mapping to determine conservation between species

Previous studies have encountered challenges with TAPT1 antibodies for immunofluorescence, with different commercial antibodies yielding inconsistent staining patterns that persisted in TAPT1 knockout cells . Researchers should be aware of these potential limitations and validate antibodies thoroughly.

What experimental approaches can determine if chicken TAPT1 functions as a cytomegalovirus receptor like its human counterpart?

The human TAPT1 gene contains a sequence orthologous to the cytomegalovirus (CMV) gH receptor . To investigate if chicken TAPT1 serves a similar function:

  • Viral Binding Assays:

    • Express chicken TAPT1 in non-susceptible cells

    • Test binding of fluorescently labeled avian herpesvirus glycoproteins

    • Perform competition assays with known viral receptors

  • Infection Susceptibility Studies:

    • Generate TAPT1 knockout chicken cell lines

    • Assess susceptibility to avian herpesvirus infection

    • Conduct rescue experiments with different TAPT1 domains

  • Structural Analysis:

    • Compare sequence homology between human and chicken TAPT1 in the putative viral binding region

    • Model chicken TAPT1 structure based on human homolog

    • Identify conserved binding motifs that might interact with viral glycoproteins

It's worth noting that recent research has questioned whether TAPT1 is necessary for human cytomegalovirus gH infection , suggesting that the chicken homolog's potential role in viral entry should be carefully evaluated.

How should researchers interpret contradictory findings about TAPT1 localization and function?

The literature contains conflicting reports regarding TAPT1 localization and function. Researchers should approach these contradictions methodically:

  • Systematic Comparison:

    • Document experimental conditions across studies (cell types, antibodies, fixation methods)

    • Consider species-specific differences (e.g., mouse vs. human vs. chicken TAPT1)

    • Evaluate the sensitivity and specificity of detection methods

  • Context-Dependent Function:

    • Test if TAPT1 localization varies by cell cycle stage or differentiation status

    • Examine if TAPT1 shuttles between multiple cellular compartments

    • Determine if post-translational modifications affect localization

  • Independent Validation:

    • Use multiple detection methods (fractionation, immunofluorescence, proximity labeling)

    • Generate fluorescently tagged TAPT1 constructs for live-cell imaging

    • Perform functional assays that don't rely solely on localization data

The most reliable studies have shown TAPT1 enrichment in ER/Golgi/mitochondrial fractions by subcellular fractionation , while also demonstrating a role in ciliogenesis , suggesting the protein may function at multiple cellular sites.

What statistical approaches are recommended for analyzing phenotypic data in TAPT1 manipulation studies?

When analyzing phenotypic data from TAPT1 studies, consider these statistical approaches:

  • For Developmental Phenotypes:

    • Fisher's exact test for categorical outcomes (e.g., presence/absence of vertebral transformations)

    • Chi-square tests for frequency comparisons across genotypes

    • ANOVA with post-hoc tests for continuous variables with multiple comparisons

  • For Cellular Phenotypes:

    • Two-tailed t-tests or Mann-Whitney tests for comparing wild-type vs. mutant

    • ANOVA for multi-group comparisons (wildtype, heterozygous, homozygous)

    • Sample sizes should include measurements from multiple independent experiments

  • For Gene Expression Analysis:

    • qPCR normalization to multiple reference genes (not just GAPDH)

    • Log-transformation of fold-change data before statistical analysis

    • Multiple testing correction for genome-wide studies

Previous TAPT1 mouse studies employed Fisher's exact test to analyze skeletal transformations, showing highly significant differences between genotypes (P < 0.0001 for T8 > T7 and splayed xiphoid process transformations) .

GenotypeT8 > T7L1 > T14Splayed XP
L1/L110/136/1311/13
Rw/+ or L1/+1/301/305/30
Fisher's exact testP < 0.0001P = 0.00165P < 0.0001

How can researchers differentiate between direct and indirect effects of TAPT1 manipulation?

Distinguishing direct from indirect effects of TAPT1 manipulation requires careful experimental design:

  • Temporal Analysis:

    • Use inducible or time-resolved manipulation systems

    • Document the sequence of phenotypic changes following TAPT1 disruption

    • Perform rescue experiments with varying timing of complementation

  • Molecular Interaction Studies:

    • Identify direct binding partners through co-immunoprecipitation or proximity labeling

    • Map protein domains required for specific interactions

    • Use point mutations that disrupt specific interactions while preserving protein stability

  • Pathway Analysis:

    • Perform transcriptome analysis at different timepoints after TAPT1 manipulation

    • Use pathway inhibitors to block potential downstream effectors

    • Compare phenotypes with known pathway mutants

When studying chicken TAPT1, researchers should consider its potential relationship with HOX genes, as mouse TAPT1 is speculated to be a downstream effector of HOXC8 , suggesting conserved developmental pathways may be affected.

How conserved is TAPT1 across species and what does this suggest about its function in chickens?

TAPT1 shows remarkable evolutionary conservation:

  • Sequence Conservation:

    • Highly similar orthologs exist from vertebrates to yeast

    • Transmembrane domains are particularly well-conserved

    • Analysis of critical domains can predict functional importance in chicken homolog

  • Functional Conservation:

    • Mouse Tapt1 mutations affect axial skeletal patterning

    • Zebrafish tapt1b knockdown affects craniofacial development

    • Human TAPT1 mutations impact skeletal development and ciliogenesis

  • Evolutionary Adaptation:

    • Compare chicken TAPT1 to reptilian counterparts to understand avian-specific adaptations

    • Examine conservation in the context of skull and vertebral adaptations for flight

The conservation of TAPT1 across diverse species suggests its function in skeletal development is likely preserved in chickens, potentially with adaptations specific to avian skeletal formation.

How do experimental findings from mammalian TAPT1 studies translate to avian models?

When applying mammalian TAPT1 findings to avian models, consider these translational aspects:

  • Developmental Timing Differences:

    • Adjust experimental timepoints to account for faster chicken development

    • Consider avian-specific developmental windows for TAPT1 manipulation

    • Map equivalent developmental stages between mammals and birds

  • Skeletal System Differences:

    • Focus on structures unique to avian development (e.g., furcula, pneumatic bones)

    • Consider how TAPT1's role might be modified in the context of avian-specific adaptations

    • Examine skeletal structures derived from neural crest cells, as TAPT1 affects their differentiation

  • Molecular Pathway Conservation:

    • Verify if chicken TAPT1 interacts with the same partners as mammalian TAPT1

    • Test if HOX gene regulation of TAPT1 is conserved in birds

    • Examine if ciliary functions of TAPT1 are preserved in avian cells

While TAPT1's fundamental roles are likely conserved, researchers should remain alert to avian-specific adaptations that might modify its function in chicken models.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.