Recombinant Chicken Transmembrane protein 121 (TMEM121)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order remarks, and we will accommodate your request.
Lead Time
Delivery times may vary based on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please contact us in advance for arrangement and associated fees.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to concentrate the contents. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
TMEM121; HOLE; Transmembrane protein 121; Protein hole
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-312
Protein Length
full length protein
Species
Gallus gallus (Chicken)
Target Names
TMEM121
Target Protein Sequence
MVLPPPDKRHVCLTTIVIMTSMAFMDAYLVEQNQGPRKIGVCIIVLVGDICFLIVLRYVA VWVGAEVKTAKRGYAMILWFLYIFVLEIKLYFIFQNYKADKKNLETVARKALTLLLSICV PGLYLVLVALDSMEYIRTFRKKEDLRGRLFWVALDLLDILDIQANLWEPHRTGLPIWAEG LMFFYCYILLLILPCVSLSEISMQGEHIAPQKMMLYPVLSLVTINIVTIFIRAINMVLFQ DSRVSTIFIGKNIIAIATKACTFLEYKRQVKEFPQNAIALELQQNSLSHNQTLHSTQGIP HEPSPTSEILDT
Uniprot No.

Target Background

Function
May play a role in MAPK signaling.
Database Links
Protein Families
TMEM121 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Transmembrane protein 121 (TMEM121) and where was it first isolated?

TMEM121 is a membrane-spanning protein that was originally isolated from chicken heart using subtraction hybridization techniques. Subsequent research has identified that TMEM121 is highly expressed in adult mouse hearts and functions as an inhibitor of pathological cardiac hypertrophy . The protein has gained recent interest in cancer research, particularly for its potential role as an inhibitor in cervical cancer development .

What are the known biological functions of TMEM121 in normal tissues?

In normal tissues, TMEM121 has been identified to have several important physiological functions:

  • It is highly expressed in adult mouse hearts where it acts as an inhibitor of pathological cardiac hypertrophy

  • It appears to play roles in regulating cell proliferation and migration

  • It interacts with multiple signaling pathways, including the PI3K/AKT pathway

  • It can influence the expression of cell cycle regulators and apoptosis-related proteins

How can TMEM121 be cloned and expressed in a laboratory setting?

The cloning and expression of recombinant TMEM121 can be accomplished through the following methodological steps:

a) RNA isolation from target tissue (e.g., chicken heart or rat adrenals) using TRIzol reagent

b) cDNA synthesis using a first-strand synthesis kit such as RevertAid

c) PCR amplification of the full coding sequence using specific primers designed to target TMEM121

d) Addition of appropriate restriction sites through a second PCR reaction:

  • For example, adding EcoR1 restriction sequence (5'-GAATTC-3') upstream of the forward primer

  • Adding HindIII restriction sequence (5'-AAGCTT-3') upstream of the reverse primer

e) Digestion of both the PCR product and target vector with restriction enzymes

f) Ligation of the insert into an expression vector (such as pIRES2-ERFP)

g) Transformation into competent cells

h) Selection and verification of transformants

i) Transfection of target cells using appropriate transfection reagents (such as TurboFect)

The efficiency of transfection can vary (35-60% has been reported for primary cells) and can be confirmed using fluorescent microscopy if using a vector with a fluorescent reporter .

What methods are most effective for detecting TMEM121 expression in experimental models?

Several complementary methods can be employed to detect and quantify TMEM121 expression:

a) Reverse Transcription PCR (RT-PCR) to detect mRNA expression

b) Real-time quantitative PCR (RT-qPCR) for quantitative assessment of expression levels

c) Immunocytofluorescence using specific antibodies against TMEM121

d) Western blotting to detect protein expression and assess relative quantities

e) Bioinformatics tools for in silico analysis, including:

  • Tumour Immune Estimation Resource (TIMER) 2.0

  • cBioPortal

  • LinkedOmics analysis

  • Kaplan-Meier plotter

  • UALCAN analysis

These methods can be used individually or in combination to provide comprehensive data on TMEM121 expression patterns across different tissues or experimental conditions.

How does TMEM121 expression influence signaling pathways in cancer cells?

TMEM121 has been shown to interact with several key signaling pathways in cancer cells, particularly in cervical cancer models:

a) PI3K/AKT pathway modulation:

  • TMEM121 overexpression downregulates phosphorylated AKT (p-AKT)

  • This suggests TMEM121 may inhibit the PI3K/AKT pathway, which is frequently hyperactivated in cancers

b) MAPK pathway interaction:

  • TMEM121 overexpression upregulates phosphorylated p38 (p-p38)

  • When TMEM121 is knocked down, phosphorylated JNK (p-JNK) and p-p38 are inhibited

  • This indicates TMEM121 may positively regulate stress-activated protein kinase pathways

c) Cell cycle regulation:

  • TMEM121 overexpression downregulates cyclin D1 and cyclin E2

  • It upregulates p27, a cell cycle inhibitor

  • When knocked down, TMEM121 promotes cyclin E1 while inhibiting p27

  • These effects may explain the anti-proliferative effects observed in cancer cells

d) Apoptosis regulation:

  • TMEM121 overexpression downregulates B-cell lymphoma 2 (BCL-2), an anti-apoptotic protein

  • This suggests TMEM121 may promote apoptotic pathways in cancer cells

e) Cell adhesion and migration:

  • TMEM121 overexpression upregulates E-cadherin

  • When knocked down, E-cadherin is inhibited

  • This suggests TMEM121 may promote cell adhesion and inhibit migration/invasion

What methodological challenges exist in producing recombinant TMEM121 and how can they be overcome?

Producing recombinant TMEM121 presents several methodological challenges that researchers should address:

a) Transfection efficiency limitations:

  • Primary cells, which are often more physiologically relevant, can be refractory to transfection

  • Studies report efficiency ranges of 35-60% even with strong cationic polymers like TurboFect

Solutions:

  • Optimize transfection conditions specifically for the cell type of interest

  • Consider electroporation for hard-to-transfect primary cells

  • Use viral vectors for higher efficiency when appropriate

  • Include selection markers to enrich for successfully transfected cells

b) Transmembrane protein expression challenges:

  • As a transmembrane protein, TMEM121 may encounter folding challenges when overexpressed

  • Proper localization to the membrane may be inconsistent

Solutions:

  • Consider using tags that don't interfere with membrane insertion

  • Include appropriate signal sequences

  • Verify proper localization using fractionation or microscopy techniques

c) Verification of functional expression:

  • Confirming that the recombinant protein functions similarly to endogenous protein

Solutions:

  • Perform rescue experiments in knockdown models

  • Compare phenotypic outcomes with known TMEM121 effects

  • Use functional assays specific to TMEM121's known activities

What experimental approaches are most effective for studying TMEM121's role in cell migration and invasion?

Several experimental approaches can be employed to study TMEM121's role in cell migration and invasion:

a) Scratch wound healing assay:

  • Research has shown that high TMEM121 expression inhibits HeLa cell migration, as measured by decreased cell scratch healing rate

  • This assay involves creating a "wound" in a confluent cell monolayer and monitoring closure over time

  • Quantification can be done by measuring the wound area at different time points

b) Transwell migration and invasion assays:

  • These assays can distinguish between simple migration and matrix invasion

  • Cells with manipulated TMEM121 expression are placed in the upper chamber

  • Migration toward a chemoattractant in the lower chamber is quantified

  • For invasion, the membrane is coated with Matrigel or similar matrix

c) Time-lapse microscopy:

  • Allows real-time tracking of individual cell movements

  • Can reveal subtle effects on directionality, velocity, and persistence

  • Particularly useful when combined with fluorescent reporters

d) Molecular analyses:

  • Assess expression of migration-related proteins (e.g., E-cadherin)

  • Monitor cytoskeletal reorganization through staining

  • Analyze focal adhesion dynamics

How does methylation status of the TMEM121 promoter correlate with its expression in different cancer types?

Research on TMEM121 has revealed important correlations between promoter methylation and expression:

a) In cervical squamous cell carcinoma and endocervical adenocarcinoma (CESC):

  • TMEM121 is significantly downregulated compared to paracancerous tissues

  • The methylation level of the TMEM121 promoter is increased in tumor tissues

  • This suggests an inverse relationship between promoter methylation and gene expression

b) Methylation as a regulatory mechanism:

  • Hypermethylation of promoters is a common mechanism for silencing tumor suppressor genes

  • The observed pattern for TMEM121 is consistent with it potentially functioning as a tumor suppressor

c) Experimental approaches to study this correlation:

What is the evidence for TMEM121 as a potential therapeutic target in cancer treatment?

The emerging evidence for TMEM121 as a potential therapeutic target in cancer includes:

a) Anti-proliferative effects:

  • Overexpression of TMEM121 in HeLa cells significantly reduces cell viability

  • This suggests that activating or mimicking TMEM121 function could inhibit cancer cell growth

b) Anti-migratory properties:

  • High TMEM121 expression inhibits cell migration in experimental models

  • This suggests potential utility in preventing metastasis

c) Molecular mechanism insights:

  • TMEM121 overexpression downregulates oncogenic factors:

    • BCL-2 (anti-apoptotic protein)

    • Cyclin D1 and cyclin E2 (cell cycle promoters)

    • Phosphorylated AKT (pro-survival signaling)

  • It upregulates tumor suppressive factors:

    • p27 (cell cycle inhibitor)

    • E-cadherin (cell adhesion molecule)

    • Phosphorylated p38 (stress response mediator)

d) Differential expression in cancer:

  • TMEM121 is significantly downregulated in cervical cancer compared to normal tissues

  • This pattern is consistent with a tumor suppressor role

e) Multi-pathway effects:

  • TMEM121's influence on multiple signaling pathways suggests it could target cancer through diverse mechanisms

  • This multi-targeted approach might reduce the development of resistance

How can researchers effectively transfect hard-to-transfect primary cells with TMEM121 constructs?

Transfecting primary cells with TMEM121 constructs can be challenging, as evidenced by the moderate transfection efficiencies (35-60%) reported even with strong cationic polymers like TurboFect . Several strategies can improve these outcomes:

a) Optimization of chemical transfection:

  • Test multiple transfection reagents (Lipofectamine, FuGENE, TurboFect, etc.)

  • Optimize cell density, DNA:reagent ratios, and incubation times

  • Use high-quality plasmid preparations (endotoxin-free)

  • Consider serum-free conditions during transfection

b) Physical methods:

  • Electroporation with optimized parameters for the specific cell type

  • Nucleofection, which combines electroporation with cell-specific solutions

  • Microinjection for very valuable or extremely difficult cells

c) Viral vector approaches:

  • Lentiviral vectors for stable integration and long-term expression

  • Adenoviral vectors for high-efficiency transient expression

  • Adeno-associated viral vectors for specific cell types

d) Verification approaches:

  • Immunocytofluorescence to confirm expression and localization

  • Western blotting to verify protein production

  • Functional assays to confirm biological activity

What are the key methodological considerations when designing RT-qPCR experiments to quantify TMEM121 expression?

When designing RT-qPCR experiments to quantify TMEM121 expression, researchers should consider:

a) Primer design:

  • Target specific transcript variants if multiple exist

  • Design primers that span exon-exon junctions to avoid genomic DNA amplification

  • Verify primer specificity through sequence analysis and melting curve analysis

  • Optimal amplicon size should be 80-150 bp for efficient amplification

b) Reference gene selection:

  • Use stable reference genes for normalization (such as β-actin as used in previous studies)

  • Validate reference gene stability across experimental conditions

  • Consider using multiple reference genes for more robust normalization

c) Protocol optimization:

  • Standardize RNA extraction methods to ensure consistent quality

  • Perform reverse transcription with consistent RNA input amounts

  • Include no-RT controls to detect genomic DNA contamination

  • Optimize cycling conditions for maximum efficiency and specificity

d) Data analysis:

  • Use the comparative Ct (ΔΔCt) method for relative quantification

  • Include technical replicates to assess precision

  • Perform biological replicates to account for natural variation

  • Apply appropriate statistical tests for comparison between groups

How can researchers isolate and identify TMEM121 protein interaction partners?

Understanding TMEM121's protein interaction network is crucial for elucidating its mechanism of action. Several approaches can be used:

a) Co-immunoprecipitation (Co-IP):

  • Use specific antibodies against TMEM121 to pull down the protein complex

  • Identify interacting partners through mass spectrometry

  • Verify key interactions through reciprocal Co-IP

  • Consider using tagged versions (FLAG, HA, etc.) if antibodies against native protein are unavailable

b) Proximity labeling techniques:

  • BioID or TurboID approaches where TMEM121 is fused to a biotin ligase

  • APEX2 proximity labeling for temporal control

  • These approaches are particularly valuable for transmembrane proteins like TMEM121

c) Yeast two-hybrid screening:

  • Use TMEM121 domains as bait to screen for interacting proteins

  • Particularly useful for identifying direct protein-protein interactions

  • Validate hits in mammalian systems

d) Protein cross-linking:

  • Chemical cross-linking followed by mass spectrometry

  • Captures transient interactions that might be missed by other methods

  • Can provide structural information about the interaction interface

e) Bioinformatic prediction and validation:

  • Use tools like STRING to predict potential interactions based on co-expression and evolutionary conservation

  • Generate hypotheses about interaction partners based on known pathway components

  • Test predictions through targeted biochemical assays

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.