Recombinant Chicken Transmembrane protein 129 (TMEM129)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
TMEM129; RCJMB04_31c10; Transmembrane protein 129
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
29-362
Protein Length
Full Length of Mature Protein
Species
Gallus gallus (Chicken)
Target Names
TMEM129
Target Protein Sequence
AGLTVQSLLAAWLGSEDAAFVQYHLRRSTGTLLAHSLLPLGYYFGMCFAAPEKHLCFFYL ASKEWKTFFFFAVLLPAVSSTMAYYWSRKGWNNHPLARTLAVYALPQSGWRAVASSINTE FRRIDKFATGAPGARVIVTDTWVIKVTTYCLHVAQQQDIHLTVTDSRQHELTPDSNMPVQ FLTIRVASVNPYVKAFDIRLNSAEYGELREKLRAPISNAANVVIHQSLSDLFLETFTSLV EMNQTYSVPSTQELEPCIGCMQTIANIKLIKNCQEPNEGECQQCYCRPMWCLTCMGKWFA SRQDQQHPETWLSSHVPCPTCRAKFCILDVCIIR
Uniprot No.

Target Background

Database Links

KEGG: gga:422900

UniGene: Gga.13540

Protein Families
TMEM129 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is TMEM129 and what is its fundamental role in cellular processes?

TMEM129 is an evolutionarily conserved, polytopic membrane protein that functions as an E3 ubiquitin ligase in the endoplasmic reticulum-associated degradation (ERAD) pathway. It contains three transmembrane domains and a long C-terminal tail that harbors an unusual cysteine-only RING domain (RING-C2) . This structure enables TMEM129 to participate in protein quality control by targeting misfolded secretory proteins for ubiquitination, dislocation from the ER, and subsequent proteasomal degradation. Unlike traditional RING domains that contain both cysteine and histidine residues in a C3HC4 or C3H2C3 arrangement, TMEM129's RING-C2 domain contains only cysteine residues for zinc coordination, making it a relatively rare type of E3 ligase . Based on current research, TMEM129 plays a crucial role in maintaining cellular proteostasis by preventing the accumulation of potentially toxic misfolded proteins within the ER lumen.

How does TMEM129 relate to the chicken immune system, particularly MHC class I molecules?

Based on research in mammalian systems, TMEM129 plays a significant role in MHC class I regulation, particularly during viral infections. In humans, cytomegalovirus protein US11 hijacks TMEM129 to degrade MHC-I signaling molecules, thereby averting immune recognition of infected cells . In chickens, MHC class I molecules show remarkable variability in surface expression levels between different haplotypes, with high-expressing haplotypes correlating with greater peptide repertoire diversity and disease resistance patterns . While direct studies of chicken TMEM129's interaction with MHC-I are lacking, the protein likely participates in similar quality control and potential immune regulatory functions. The chicken MHC has strong genetic associations with resistance and susceptibility to certain infectious pathogens, and understanding TMEM129's role could provide insights into these variable immune responses across chicken lineages . The thermostability of chicken MHC class I molecules also varies between haplotypes, which could potentially involve ERAD components like TMEM129.

What is the predicted structure of chicken TMEM129 compared to mammalian orthologs?

Chicken TMEM129 likely maintains the core structural features found in mammalian TMEM129, including three transmembrane domains that anchor it in the ER membrane and a cytosolic C-terminal domain containing the RING-C2 E3 ligase domain. The RING-C2 domain of mammalian TMEM129 is unusual because it contains only cysteine residues for zinc coordination and features extended loops between its zinc-coordinating cysteines (AA289-308 and AA323-345) . Additionally, it contains a canonical E2 binding site, with specific conserved residues including an isoleucine between the first two cysteines, a tryptophan in position 4 of the second loop, and a proline between the final two cysteine residues . While chicken-specific structural data is limited, computational modeling would suggest preservation of these unusual features, given the general conservation of E3 ligase functional domains across vertebrate species. Subtle species-specific variations might exist that could influence substrate specificity or interaction with avian-specific binding partners.

What role might chicken TMEM129 play in avian virus infections and immune evasion?

Based on mammalian studies, chicken TMEM129 likely plays a dual role during viral infections - both as part of the host defense mechanism through protein quality control and as a potential target for viral immune evasion strategies. In human cytomegalovirus (HCMV) infections, the viral US11 protein hijacks TMEM129 to degrade MHC-I molecules, preventing infected cell recognition by cytotoxic T lymphocytes . Avian viruses may employ similar strategies targeting chicken TMEM129. Given the prevalence and economic impact of avian influenza, investigating whether influenza proteins interact with chicken TMEM129 would be particularly valuable. Recent advances in creating influenza-resistant chickens through CRISPR/Cas9 editing of ANP32A suggest that understanding TMEM129's role could potentially identify additional targets for generating disease-resistant poultry. Research should focus on whether chicken TMEM129 is essential for the replication of specific avian viruses and if TMEM129-dependent pathways represent vulnerability points that viruses exploit.

How does the RING-C2 domain of chicken TMEM129 contribute to its E3 ligase activity?

The RING-C2 domain of TMEM129 is highly unusual among E3 ligases, containing only cysteine residues for zinc coordination instead of the typical cysteine/histidine combination found in classic RING domains . In mammalian TMEM129, this domain is functional and essential for ubiquitination activity. When examining chicken TMEM129, researchers should investigate whether this unusual domain exhibits conserved enzymatic properties or has evolved avian-specific features. Key questions include whether chicken TMEM129's RING-C2 domain maintains the same zinc-binding stoichiometry as mammalian TMEM129, whether the extended loops between zinc-coordinating cysteines serve species-specific functions, and whether the E2-binding interface is conserved. In vitro ubiquitination assays using recombinant chicken TMEM129 with mutations in key cysteine residues would help characterize its catalytic mechanism. Understanding the molecular basis of chicken TMEM129's E3 ligase activity could provide insights into species-specific differences in ERAD pathways and potentially reveal novel regulatory mechanisms.

What E2 conjugating enzymes partner with chicken TMEM129?

In mammalian cells, TMEM129 specifically recruits the ER-membrane tail-anchored E2 ubiquitin conjugase Ube2J2 for MHC-I ubiquitination . Through systematic screening of E2 enzymes, researchers determined that only Ube2J2, not the related Ube2J1, was essential for TMEM129-mediated ubiquitination . For chicken TMEM129, the E2 partner(s) remain unidentified but represent critical components of its functional machinery. Researchers should investigate whether chicken Ube2J2 orthologs function similarly with chicken TMEM129 or if avian-specific E2 partnerships have evolved. Methodologically, this could be approached through co-immunoprecipitation studies with recombinant chicken TMEM129, yeast two-hybrid screens, or functional depletion studies in chicken cell lines. Understanding these enzyme partnerships is crucial because E2-E3 pairs often determine the type of ubiquitin chains formed (K48, K63, etc.), which in turn dictate the fate of ubiquitinated substrates. The specificity of chicken TMEM129 for particular E2 enzymes may reveal important aspects of avian ERAD pathway organization and efficiency.

How does chicken TMEM129 compare with other avian E3 ligases involved in immune regulation?

The avian immune system employs multiple E3 ubiquitin ligases to regulate protein turnover and immune signaling. Comparing chicken TMEM129 with other characterized avian E3 ligases would provide valuable context for understanding its specialized functions. Unlike many E3 ligases, TMEM129 belongs to the rare group containing RING-C2 domains, which might confer unique substrate specificity or regulatory properties . Researchers should investigate whether chicken TMEM129 occupies a distinct niche in avian immunity compared to other E3 ligases. Particular attention should be paid to comparing TMEM129 with the SEL1L/HRD1 complex, which was identified in mammalian studies as handling "free" US11 degradation while TMEM129 targeted US11-associated MHC-I . This functional specialization suggests distinct but complementary roles for different ERAD E3 ligases. Comparative studies examining expression patterns, substrate preferences, and viral targeting across different avian E3 ligases would help establish the relative importance of TMEM129 in chicken immune defense and protein quality control systems.

What potential genetic variations exist in chicken TMEM129 across different breeds or lineages?

Given the strong genetic associations between chicken MHC haplotypes and disease resistance , investigating TMEM129 polymorphisms across chicken breeds could reveal correlations with immune function or disease susceptibility. Researchers should examine whether certain TMEM129 variants are enriched in chicken populations known for resistance to specific pathogens. Of particular interest would be variations within the RING-C2 domain or in regions mediating protein-protein interactions, as these could directly impact TMEM129's functional properties. Genome-wide association studies connecting TMEM129 variants with disease outcomes would be valuable. Additionally, comparing TMEM129 sequences across commercial broiler lines, layer hens, and wild/heritage breeds might reveal selection pressures on this gene during chicken domestication and breeding. Understanding the natural variation in TMEM129 could potentially inform breeding programs aiming to enhance disease resistance in commercial poultry, similar to how understanding ANP32A led to strategies for creating influenza-resistant chickens .

What expression systems are optimal for producing functional recombinant chicken TMEM129?

Producing functional recombinant chicken TMEM129 requires careful consideration of expression systems that can accommodate its complex membrane topology and post-translational modifications. Mammalian expression systems (HEK293 or CHO cells) offer advantages for membrane proteins, providing appropriate ER machinery and chaperones for proper folding. Insect cell systems (Sf9 or High Five) represent another viable option, often yielding higher protein quantities while maintaining most post-translational modifications. For chicken TMEM129, researchers should consider adding purification tags (His, FLAG, or Strep) to either the N-terminus (before the first transmembrane domain) or C-terminus, with TEV protease cleavage sites for tag removal. Baculovirus expression systems may be particularly suitable for chicken TMEM129, as they have proven successful for other multi-pass membrane proteins. To assess functionality, expressed TMEM129 should be evaluated for proper membrane integration, zinc coordination in the RING-C2 domain, and in vitro ubiquitination activity. Creating truncated versions containing only the cytosolic RING-C2 domain might provide higher yields for structural studies while still retaining catalytic activity.

How can researchers effectively characterize the E3 ligase activity of recombinant chicken TMEM129?

Characterizing the E3 ligase activity of recombinant chicken TMEM129 requires establishing reliable in vitro ubiquitination assays. These assays typically include purified recombinant TMEM129 (or its RING-C2 domain), a compatible E2 enzyme (likely chicken Ube2J2 ortholog based on mammalian studies ), ubiquitin, ATP, E1 enzyme, and potential substrates. Researchers should monitor ubiquitination through Western blotting, using anti-ubiquitin antibodies to detect ubiquitin chains or shifts in substrate molecular weight. For kinetic analysis, time-course experiments with varying enzyme concentrations would provide insights into catalytic efficiency. Mutational analysis targeting conserved cysteine residues in the RING-C2 domain would help identify residues critical for catalytic activity. Additionally, researchers should investigate the chain type specificity (K48, K63, etc.) of chicken TMEM129-mediated ubiquitination using ubiquitin mutants with specific lysine-to-arginine substitutions. Comparing the activity of chicken TMEM129 with mammalian orthologs under identical conditions would highlight species-specific functional differences. Assessing activity across different pH and temperature ranges might reveal adaptations specific to avian cellular environments.

What approaches can identify the natural substrates of chicken TMEM129?

Identifying the natural substrates of chicken TMEM129 represents a significant challenge requiring complementary approaches. Proximity-dependent biotin identification (BioID) or APEX2 techniques, where chicken TMEM129 is fused to a biotin ligase, can label proteins in close proximity within living cells, potentially capturing transient E3-substrate interactions. Stable isotope labeling with amino acids in cell culture (SILAC) combined with immunoprecipitation of TMEM129 followed by mass spectrometry can identify differentially abundant proteins in wild-type versus TMEM129-knockout conditions. Researchers should also employ global ubiquitinome analysis comparing control and TMEM129-depleted chicken cells to identify proteins with altered ubiquitination status. Given TMEM129's role in ER-associated degradation, focusing on proteins processed through the secretory pathway is advisable. Validation of potential substrates should include co-immunoprecipitation with TMEM129, in vitro ubiquitination assays, and assessment of candidate substrate stability in cells with normal versus depleted TMEM129 levels. Particular attention should be paid to MHC class I molecules and other immune-related proteins given mammalian TMEM129's role in MHC-I degradation during viral infections .

How can CRISPR/Cas9 gene editing be applied to study chicken TMEM129 function?

CRISPR/Cas9 technology offers powerful approaches for studying chicken TMEM129 function in vivo and in vitro. For cellular studies, researchers can generate TMEM129-knockout chicken cell lines (such as DT40 B cells or primary chicken embryonic fibroblasts) by targeting early exons or critical functional domains. For structure-function analysis, CRISPR can introduce specific mutations in the RING-C2 domain to assess their impact on E3 ligase activity and substrate recognition. Tag-knock-in approaches can generate endogenously tagged TMEM129 for localization and interaction studies without overexpression artifacts. For in vivo studies, CRISPR editing of chicken primordial germ cells followed by germline transmission can generate chicken lines with modified TMEM129, similar to the approach used to create influenza-resistant chickens through ANP32A modification . When designing CRISPR experiments, researchers should carefully select guide RNAs with minimal off-target effects and include appropriate controls to verify editing efficiency. Phenotypic analysis of TMEM129-edited chickens should focus on immune function, response to viral challenges, and potential developmental effects, given TMEM129's role in protein quality control.

What structural analysis techniques are most appropriate for chicken TMEM129?

Structural characterization of chicken TMEM129 presents challenges due to its membrane integration and flexible domains. For full-length protein, cryo-electron microscopy (cryo-EM) represents the most promising approach, particularly if TMEM129 can be purified in nanodiscs or amphipols to maintain native membrane environment. For the soluble RING-C2 domain, X-ray crystallography or NMR spectroscopy might be feasible, focusing on the C-terminal region containing the E3 ligase activity. Hydrogen-deuterium exchange mass spectrometry (HDX-MS) can provide valuable information about protein dynamics and conformational changes upon E2 or substrate binding without requiring crystallization. Small-angle X-ray scattering (SAXS) might yield low-resolution structural information about domain organization and flexibility. Researchers should also consider computational approaches, including homology modeling based on mammalian TMEM129 structures (if available) or ab initio modeling with experimental validation. Additionally, crosslinking mass spectrometry can provide distance constraints to inform structural models by identifying residues in close proximity. Structural studies should prioritize understanding the zinc coordination in the unusual RING-C2 domain and the binding interface with E2 enzymes, as these features directly relate to TMEM129's catalytic mechanism.

How might characterization of chicken TMEM129 contribute to improved poultry disease resistance?

Understanding chicken TMEM129's role in immune regulation could open new avenues for enhancing disease resistance in commercial poultry. If TMEM129 proves essential for certain avian viral infections, similar to how ANP32A is required for influenza virus replication , it could become a target for genetic modification to create disease-resistant chicken lines. Researchers should investigate whether specific TMEM129 variants correlate with natural resistance to economically important avian pathogens. If certain pathogens exploit TMEM129 for immune evasion, as human cytomegalovirus does through US11 , creating chickens with modified TMEM129 resistant to such manipulation could enhance immunity while maintaining normal protein quality control. Additionally, pharmacological modulators of TMEM129 activity might serve as novel antivirals for poultry. The recent success in generating influenza-resistant chickens through targeted modifications of ANP32A provides a blueprint for similar approaches targeting TMEM129 if it proves to be involved in pathogen lifecycles. Multi-omics studies correlating TMEM129 expression or variants with disease outcomes across different chicken populations could identify specific conditions where TMEM129-focused interventions would be most beneficial.

How does TMEM129 function differ between avian and mammalian systems?

Comparative studies between chicken and mammalian TMEM129 could reveal important evolutionary adaptations in ERAD pathways across vertebrate lineages. Researchers should investigate whether chicken TMEM129 recognizes the same range of substrates as mammalian orthologs or has evolved specificity for avian-specific proteins. Cross-species complementation experiments, where chicken TMEM129 is expressed in mammalian TMEM129-knockout cells (and vice versa), would determine functional conservation. Particularly interesting would be whether chicken TMEM129 can be hijacked by mammalian viruses like HCMV, which exploits human TMEM129 through US11 . Conversely, researchers should investigate whether avian viruses have evolved mechanisms to manipulate TMEM129 for immune evasion. Differences in protein interaction networks between avian and mammalian TMEM129 might reveal species-specific regulatory mechanisms. Temperature sensitivity is another important area to explore, as chickens maintain a higher body temperature (41-42°C) than mammals, which might necessitate adaptations in protein quality control systems. Understanding these differences could provide insights into the evolution of ERAD pathways and species-specific disease susceptibilities.

What potential exists for developing chicken TMEM129 as a target for antiviral interventions?

Based on mammalian studies showing TMEM129's exploitation by viruses , chicken TMEM129 might represent a viable target for developing novel antiviral strategies for poultry. If specific avian viruses depend on or manipulate TMEM129, small molecule inhibitors disrupting these interactions could have therapeutic value. Researchers should conduct high-throughput screens with recombinant chicken TMEM129 to identify compounds that modulate its E3 ligase activity or prevent viral protein interactions. RNA interference or antisense oligonucleotides targeting TMEM129 might provide temporary protection during outbreak situations if TMEM129 downregulation doesn't severely impact normal cellular functions. For longer-term solutions, gene editing technologies could create chicken lines with TMEM129 variants resistant to viral manipulation while maintaining normal protein quality control functions, similar to the approach with ANP32A for influenza resistance . Peptide-based inhibitors mimicking key interaction domains could also selectively disrupt pathogen-TMEM129 interactions while preserving beneficial functions. Economic analyses would need to determine the cost-effectiveness of these approaches compared to current vaccination and biosecurity measures in commercial poultry production.

How might TMEM129 interact with the unique features of the chicken MHC system?

The chicken MHC differs significantly from mammalian MHC in several respects, including its compact size, limited gene duplications, and strong disease associations . Researchers should investigate whether TMEM129 has evolved specific adaptations to interact with the chicken MHC system. Of particular interest is whether TMEM129 contributes to the observed differences in MHC class I surface expression levels between chicken haplotypes, which can vary as much as 10-fold and correlate inversely with peptide repertoire diversity and disease resistance . Studies should examine whether TMEM129 activity varies across chicken lines with different MHC haplotypes and if this correlates with differences in MHC-I thermostability or cell surface expression. Co-immunoprecipitation experiments could determine if chicken TMEM129 directly interacts with MHC-I heavy chains or associated components like TAP transporters, which show high allelic polymorphism in chickens . Understanding these interactions could provide insights into the evolution of vertebrate immune regulation and the unique features of avian immunity. This knowledge might also explain some of the strong genetic associations between chicken MHC haplotypes and resistance to specific pathogens.

Table 1: Predicted Properties of Chicken TMEM129 Compared to Mammalian Orthologs

PropertyHuman TMEM129Mouse TMEM129Chicken TMEM129 (predicted)
Protein length362 aa ~362 aa~360-370 aa (predicted)
Molecular weight36 kDa ~36 kDa~36-38 kDa (predicted)
Transmembrane domains3 33 (predicted)
RING-C2 domainPresent, C-terminal Present, C-terminalPresent, C-terminal (predicted)
Cellular localizationER membrane ER membraneER membrane (predicted)
E2 partnerUbe2J2 Ube2J2Unknown (likely Ube2J2 ortholog)

Table 2: Recommended Experimental Approaches for Chicken TMEM129 Characterization

Research QuestionRecommended MethodsKey Controls
Protein expression patternImmunohistochemistry, Western blotTMEM129 knockout tissues
Subcellular localizationConfocal microscopy, subcellular fractionationER, Golgi, plasma membrane markers
E3 ligase activityIn vitro ubiquitination assaysRING domain mutants
Substrate identificationBioID, SILAC-MS, ubiquitinome analysisTMEM129 catalytic mutants
Viral interactionsCo-IP, proximity labeling, viral challengeMultiple virus families
Structure determinationCryo-EM, X-ray crystallography (RING domain)Negative stain EM validation

Table 3: Proposed CRISPR/Cas9 Targeting Strategy for Chicken TMEM129

Target RegionGuide RNA Design ConsiderationsExpected Phenotype
Early exonsMultiple guides for complete KOLoss of all TMEM129 function
RING-C2 domainTarget zinc-coordinating cysteinesCatalytically inactive protein
Transmembrane domainsTarget membrane integrationMislocalized protein
E2 binding interfaceConserved residues in RING domainUnable to recruit E2 enzyme
C-terminal tag knock-inHomology-directed repair with tag sequenceEndogenously tagged protein

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.