Recombinant Chicken Transmembrane protein 184C (TMEM184C)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant TMEM184C is produced via heterologous expression, followed by affinity chromatography. Key protocols include:

  • Expression: Optimized in E. coli for soluble yield, with codon-adaptation for chicken mRNA .

  • Purification: Nickel-NTA columns for His-tagged variants; purity >90% confirmed by SDS-PAGE .

  • Storage: Lyophilized powder in Tris/PBS buffers with trehalose or glycerol to prevent aggregation .

Functional Studies

  • Membrane Protein Interactions: Used to study binding partners in signaling pathways, leveraging its conserved transmembrane domains .

  • Growth Regulation: Indirectly linked to growth hormone pathways via paralogs (e.g., TMEM263 in dwarf chickens) .

Technical Uses

ApplicationExample
ImmunoprecipitationPre-coupled magnetic beads for high-throughput protein interaction studies
Structural BiologyCrystallography trials using purified full-length protein
Diagnostic AssaysELISA development for detecting TMEM184C in biological samples

Comparative Analysis Across Species

Recombinant TMEM184C variants from other species highlight functional conservation:

SpeciesUniProt IDLength (aa)Key Differences
HumanQ9NVA4438Shorter N-terminal region; 89% identity to chicken
RatQ810F5503Extended C-terminus with additional phosphorylation sites
ChickenQ5ZMP3445Full-length wild-type structure

Key Research Findings

  • Conserved Role: TMEM184C’s transmembrane domains are critical for structural integrity, as truncations (e.g., p.Trp59* in TMEM263) disrupt function .

  • Ubiquitous Expression: Detected in skeletal muscle, liver, and embryonic tissues, suggesting roles in development .

Future Directions

  • Functional Knockout Models: To elucidate its role in avian growth disorders.

  • Structural Resolution: Cryo-EM studies to map interaction interfaces .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order remarks. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us beforehand as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
TMEM184C; TMEM34; RCJMB04_1i7; Transmembrane protein 184C; Transmembrane protein 34
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-445
Protein Length
full length protein
Species
Gallus gallus (Chicken)
Target Names
TMEM184C
Target Protein Sequence
MPCTCGNWRRWIRPLVVLLYIVGLLVVVPLCVWELQKLEVGIHTKAWFIAGIFLLMTIPI SLWGILQHLVHYTQPELQKPIIRILWMVPIYSLDSWIALKYPNIAIYVDTCRECYEAYVI YNFMVFLSNYLTNRYPNLVLIIEAKDQQRHLPPLCCCPSWAMGEVLLFRCKLGVLQYTVV RPFTTIIALICELVGVYDEGNFSFDNAWTYLVILNNMSQLFAMYCLVLFYKVLREELNPI QPVGKFLCVKMVVFVSFWQAVLIALLVKVGVISEKHTWEWQSVEAVATGLQDFIICVEMF LAAIAHHYSFSYKPYVQEAEEGSCFDSFLAMWDISDIRADISEQVRNVGRTVLGQPRKMF FAEDHEQNEHTSLLSSSTQDPISDASSMPSSPMGHYQGFGHTVTPLTTPTTVPVVDGIYN TSATRDTEESPELMHNSSEKALDRS
Uniprot No.

Target Background

Function
This protein may play a role in cell growth.
Database Links

KEGG: gga:422469

UniGene: Gga.49220

Protein Families
TMEM184 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What are the optimal storage and handling conditions for recombinant chicken TMEM184C?

For optimal stability and activity of recombinant chicken TMEM184C protein:

  • Storage Temperature: Store at -20°C for routine use; for extended storage, maintain at -20°C or -80°C

  • Storage Buffer: Typically supplied in Tris-based buffer with 50% glycerol, optimized for protein stability

  • Freeze-Thaw Cycles: Repeated freezing and thawing is not recommended as it may lead to protein denaturation and loss of activity

  • Working Aliquots: Store working aliquots at 4°C for up to one week to minimize freeze-thaw cycles

When planning experiments, consider:

  • Performing pilot studies to determine optimal protein concentration for your specific application

  • Including appropriate controls to account for buffer effects

  • Confirming protein stability after experimental manipulations through activity assays or structural analyses

What detection methods are available for chicken TMEM184C in experimental settings?

Several methods can be employed for detecting and studying chicken TMEM184C:

Antibody-Based Detection:

  • Commercially available antibodies against TMEM184C can be used for Western blot, immunohistochemistry, and immunofluorescence applications

  • While some antibodies may not be specifically raised against the chicken variant, cross-reactivity analysis suggests that antibodies against human TMEM184C may work with mouse samples and potentially with chicken samples due to sequence homology

Recommended Detection Methods:

  • Western Blot: Typically performed at 1 μg/mL antibody concentration

  • Immunohistochemistry: Start at 5 μg/mL antibody concentration

  • Immunofluorescence: Begin with 20 μg/mL antibody concentration

  • ELISA: Commercial ELISA kits for recombinant TMEM184C are available for quantitative detection

When designing detection experiments, researchers should:

  • Include appropriate positive and negative controls

  • Validate antibody specificity for the chicken variant

  • Optimize detection conditions for each specific experimental system

How does TMEM184C expression differ across chicken tissues?

While comprehensive chicken-specific TMEM184C expression data is limited in the provided search results, general principles for analyzing tissue-specific expression can be applied:

  • Expression Analysis Approach:

    • RNA-seq or quantitative PCR can be used to measure TMEM184C mRNA levels across different tissues

    • Protein expression can be assessed through Western blotting or immunohistochemistry

    • GTEx data for human TMEM184C provides a reference point for potential expression patterns

  • Experimental Considerations:

    • Use age-matched, same-sex chickens when comparing across tissues

    • Control for environmental factors that might affect expression

    • Include multiple biological replicates (n≥3) for statistical reliability

    • Normalize expression against appropriate reference genes validated for chicken tissues

Similar genes in the TMEM184 family show tissue-specific expression patterns in other species, which could inform hypotheses about chicken TMEM184C distribution.

What functional roles does TMEM184C play in chicken cellular physiology?

Based on comparative studies with TMEM184C in other species and related proteins, several potential functions can be hypothesized for chicken TMEM184C:

Potential Cellular Functions:

  • Cell Growth Regulation: Rat TMEM184C has been described as a "possible tumor suppressor which may play a role in cell growth" . Similar functions may exist in the chicken ortholog.

  • Membrane Transport: TMEM184C belongs to the TOG superfamily which includes transporters, suggesting it may function in transmembrane transport of specific molecules .

  • Signaling Pathway Involvement: Related TMEM184 proteins in mammals have been associated with:

    • Endosomal localization and recycling (TMEM184A, TMEM184B)

    • Receptor-like functions (TMEM184A acts as a heparin receptor in vascular cells)

Experimental Approaches to Study Function:

  • Loss-of-function studies: CRISPR/Cas9 knockout or siRNA knockdown in chicken cell lines

  • Overexpression studies: Adenoviral vectors expressing chicken TMEM184C are available

  • Protein-protein interaction studies: Co-immunoprecipitation followed by mass spectrometry

  • Subcellular localization: Immunofluorescence or fluorescent protein tagging

A structured approach combining these methods would provide insights into the specific roles of TMEM184C in chicken cells.

How can protein structure prediction be applied to understand chicken TMEM184C function?

Structure prediction approaches can provide valuable insights into TMEM184C function:

Alphafold Prediction Method:
The approach used for TMEM184B structure prediction can be applied to chicken TMEM184C :

  • Extract native protein sequence from Uniprot (Q5ZMP3)

  • Generate 3D structures using Alphafold with MMSeq2

  • Evaluate quality using PLDDT and PAE scores

  • Assess predicted protein geometry via Ramachandran plot analysis

  • Focus particularly on transmembrane regions, which tend to be more reliably predicted

Structure-Function Analysis:

  • Pore Domain Identification: TMEM184B contains a pore domain where disease-associated variants cluster ; analogous domains may exist in TMEM184C

  • Binding Pocket Prediction: Computational tools can identify potential ligand-binding sites

  • Variant Effect Analysis: Modeling the effects of amino acid substitutions on protein stability

  • Evolutionary Conservation Mapping: Identifying highly conserved regions likely crucial for function

Example Data Table: Structure Prediction Quality Assessment Metrics

MetricDescriptionTarget ValueInterpretation
PLDDTPer-residue confidence score>70Higher values indicate more reliable prediction
PAEPredicted aligned error<5ÅLower values indicate higher confidence in domain positioning
Ramachandran% residues in favored regions>90%Higher percentages indicate better backbone geometry
TM-scoreTemplate modeling score for fold assessment>0.5Scores >0.5 suggest correct global fold

What gene editing approaches are most effective for studying TMEM184C function in chicken models?

CRISPR/Cas9 technology has revolutionized gene editing in avian systems:

CRISPR/Cas9 Strategies for TMEM184C:

  • Knockout Approaches:

    • Design gRNAs targeting early exons of TMEM184C

    • Verify knockout efficiency via sequencing, protein detection, and functional assays

    • Consider potential compensatory mechanisms by related genes

  • Knock-in Approaches:

    • Insert reporter tags (GFP, FLAG) to study localization and interactions

    • Create specific point mutations to test structure-function hypotheses

    • Generate conditional alleles for tissue-specific or temporal control

  • Base Editing and Prime Editing:

    • For precise nucleotide changes without double-strand breaks

    • Particularly valuable for testing specific amino acid variants

Delivery Methods in Chicken Models:

  • Primordial Germ Cell Modification: For generating genetically modified chickens

  • In Ovo Electroporation: For developmental studies

  • Viral Vector Delivery: For post-hatch studies

  • Cell Line Transfection: For in vitro mechanistic studies

Recent advances in genome editing technologies have facilitated the creation of genetically modified chickens, which can serve as valuable models for studying TMEM184C function in vivo .

How does chicken TMEM184C compare to its orthologs in other species?

Understanding evolutionary conservation provides insights into critical functional domains:

Cross-Species Comparison:

SpeciesHomology to Chicken TMEM184CKey Functional DifferencesKnown Functions
HumanModerate-highNot yet fully characterizedPotentially involved in cancer suppression
RatHighSimilar domain organizationPossible tumor suppressor; role in cell growth
XenopusModerateShared family membershipNot well characterized
ZebrafishModerateConserved domainsPredicted transmembrane transporter activity
Bovine~87% (based on immunogen sequence)Similar to other mammalsNot well characterized

Evolutionary Insights:

  • Highly conserved regions likely represent functional domains essential across species

  • Variable regions may reflect species-specific adaptations

  • The InterPro family IPR005178 (Organic solute transporter subunit alpha/Transmembrane protein 184) is conserved across vertebrates

Functional Implications:

  • Conservation suggests fundamental cellular roles

  • Cross-species differences may reflect adaptation to different cellular environments

  • Insights from well-studied orthologs (e.g., mammalian TMEM184C) may guide chicken-specific research

What are the methodological challenges in studying chicken TMEM184C and how can they be addressed?

Researchers face several challenges when studying chicken TMEM184C:

Common Challenges and Solutions:

  • Limited Availability of Chicken-Specific Research Tools:

    • Solution: Validate cross-reactivity of tools developed for other species

    • Approach: Test antibodies against recombinant chicken TMEM184C and validate specificity

    • Alternative: Develop custom antibodies using chicken-specific sequences as immunogens

  • Difficulty in Distinguishing Between TMEM184 Family Members:

    • Solution: Design highly specific primers/probes for quantitative PCR

    • Approach: Target unique regions identified through sequence alignment

    • Validation: Confirm specificity using control samples with known expression profiles

  • Subcellular Localization Determination:

    • Solution: Use multiple complementary approaches

    • Methods: Combine immunofluorescence, subcellular fractionation, and proximity labeling techniques

    • Controls: Include markers for relevant cellular compartments

  • Functional Redundancy with Related Proteins:

    • Solution: Perform comprehensive knockdown/knockout of multiple family members

    • Approach: CRISPR/Cas9 multiplex editing or combinatorial RNAi

    • Analysis: Epistasis experiments to determine genetic interactions

  • Translation to In Vivo Significance:

    • Solution: Develop appropriate chicken models

    • Approach: Combine in vitro studies with targeted genetic modifications in chickens

    • Validation: Correlate findings with natural genetic variation in chicken populations

How can chicken TMEM184C be effectively used in bioreactor applications for protein drug production?

Considering the emerging importance of chickens as bioreactors for protein-based drugs:

Advantages of Chicken-Based Expression Systems:

  • Short production cycle

  • High production efficiency

  • Lower research costs compared to mammalian systems

  • Expression products closer to their natural state

  • Easier purification from egg whites

Methodological Approach for TMEM184C Production:

  • Vector Design:

    • Optimize codon usage for chicken expression

    • Include strong promoters (e.g., ovalbumin promoter for egg white expression)

    • Add appropriate signal sequences for secretion

    • Consider fusion tags for detection and purification

  • Gene Delivery Methods:

    • CRISPR/Cas9-mediated targeted integration

    • Primordial germ cell modification for germline transmission

    • Lentiviral transduction for cell line establishment

  • Expression System Optimization:

    • Select appropriate chicken cell lines or egg production systems

    • Optimize culture conditions for maximum protein yield

    • Develop efficient purification protocols specific to egg white matrix

  • Quality Control:

    • Assess protein integrity via mass spectrometry

    • Verify glycosylation patterns

    • Confirm biological activity through functional assays

Chicken bioreactors present a promising avenue for recombinant protein production with advantages in scale-up potential and post-translational modifications appropriate for therapeutic applications .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.