Recombinant Chicken Transmembrane protein 208 (TMEM208)

Shipped with Ice Packs
In Stock

Description

General Information

TMEM208 is an evolutionarily conserved protein containing a domain of unknown function (DUF788) that spans almost the entire sequence . It is a transmembrane protein located in the endoplasmic reticulum (ER) . TMEM208 is found in various species, highlighting its conserved nature .

Subcellular Localization

TMEM208 is specifically localized within the endoplasmic reticulum (ER) . Studies using confocal microscopy confirm that TMEM208 co-localizes with ER markers such as ER-DsRed and calnexin . It does not co-localize with Golgi, lysosomes, or mitochondria, indicating its specific presence in the ER .

Role in ER Stress and Autophagy

TMEM208 plays a role in regulating ER stress and autophagy . Overexpression of TMEM208 downregulates mRNA levels of ER stress marker molecules like ATF6, ATF4, and CHOP, as well as autophagy molecules like LC3, ATG5, and ATG12 . Conversely, knockdown of TMEM208 upregulates mRNA levels of GRP78, ATF6, ATF4, LC3, ATG5, CHOP, and ATG12 . TMEM208 activity impairs DTT-mediated ER stress and autophagy . Inhibition of TMEM208 strengthens DTT-mediated ER stress and autophagy .

Interaction with Frizzled (Fz)

Research indicates that Tmem208 interacts with Frizzled (Fz), a planar cell polarity (PCP) receptor, and helps maintain proper levels of Fz .

Functional Conservation

A human TMEM208 transgene can rescue the loss of Tmem208 in flies, demonstrating functional conservation across species .

Clinical Significance

A child with compound heterozygous variants in TMEM208 presented with developmental delay, skeletal abnormalities, multiple hair whorls, cardiac, and neurological issues, symptoms associated with PCP defects . Fibroblasts from this individual also displayed mild ER stress .

Impact on Development

Loss of Tmem208, the fly ortholog of human TMEM208, results in lethality, and surviving flies exhibit defects in wing and eye development, indicative of impaired cell polarity .

Key Research Findings

FindingDescription
LocalizationTMEM208 is localized within the endoplasmic reticulum (ER) .
Regulation of ER StressOverexpression of TMEM208 downregulates ER stress marker molecules, while knockdown upregulates them .
Regulation of AutophagyTMEM208 negatively correlates with the modulation of ER-stress and autophagy .
Interaction with Frizzled (Fz)Tmem208 interacts with Frizzled (Fz), a component of the PCP pathway, and helps maintain proper levels of Fz .
Phenotypes of TMEM208 LossLoss of Tmem208 in flies results in lethality and developmental defects .
Rescue by Human TMEM208A human TMEM208 transgene rescues the lethality of Tmem208 mutants in flies, indicating functional conservation .
Clinical Presentation in HumansA child with TMEM208 variants showed developmental delay, skeletal abnormalities, and other issues, suggesting a link to PCP defects .
ER Stress and Planar Cell Polarity (PCP)The study uncovers a role of TMEM208 in development, shedding light on its significance in ER homeostasis and cell polarity .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
TMEM208; RCJMB04_13i12; Transmembrane protein 208
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-179
Protein Length
full length protein
Species
Gallus gallus (Chicken)
Target Names
TMEM208
Target Protein Sequence
MAPKGKAGTKGKKQIFEENRETLRFYLRIILGASAVYAAVNLVVFYPAASAWTWLAFAFS SAVYGASYRSMSSMARPAFADDGSLADGGIDLNMEQGWQSECPHPHEPRHLKDVILLTAM VQVLSCFSLYVWYFWLLAPGRALYLLWVNILGPWFTAESSAPGQEPNEKKQRRTGTPPE
Uniprot No.

Target Background

Function
May function as a negative regulator of endoplasmic reticulum stress-induced autophagy.
Database Links
Protein Families
TMEM208 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

How conserved is TMEM208 across species?

TMEM208 is highly conserved across multicellular organisms. Functional studies demonstrate that human TMEM208 can fully rescue the loss of Tmem208 in Drosophila, indicating strong evolutionary conservation of function . Sequence alignment analyses reveal significant homology between chicken TMEM208 (Q5ZK32) and its orthologs in human, mouse, and other vertebrates. This conservation suggests critical functional importance across species .

What experimental approaches can be used to study chicken TMEM208 expression patterns?

Several complementary approaches can be used to study chicken TMEM208 expression:

  • RT-PCR analysis: For tissue-specific expression profiling across different chicken tissues

  • Western blot analysis: Using anti-TMEM208 antibodies to quantify protein levels

  • Immunohistochemistry: To visualize the spatial distribution in tissues

  • Tagged protein expression: Using TMEM208-GFP fusion proteins to track subcellular localization

  • RNA-seq: For transcriptome-wide expression analysis across developmental stages

For optimal results, combine these approaches to correlate mRNA and protein expression levels in targeted tissues .

What is the role of TMEM208 in protein translocation to the ER?

TMEM208 functions in the signal-independent pathway that facilitates the translocation of nascent proteins into the ER. Recent biochemical studies reveal that TMEM208 interacts with the Signal Recognition Particle (SRP) specifically in regions used by SRP to bind cargo proteins .

The mechanism involves:

  • TMEM208 accelerates the release of cargo from SRP once the SRP-cargo complex arrives at the ER

  • Without TMEM208, SRP releases cargo more slowly, particularly affecting hydrophobic proteins

  • This delayed release is especially problematic for multipass membrane proteins that require precise insertion into the membrane

This function is critical for efficient protein delivery to the ER, particularly for multipass membrane proteins that span the membrane multiple times (such as transporters and channels) .

How can researchers experimentally assess TMEM208 function in protein translocation?

To assess TMEM208's role in protein translocation, researchers can:

  • In vitro reconstitution assays:

    • Recapitulate membrane protein biogenesis in cell-free systems using extracts with or without TMEM208

    • Track cargo release rates from SRP in the presence and absence of recombinant TMEM208

  • Pulse-chase experiments:

    • Monitor the kinetics of membrane protein insertion and translocation

    • Compare wild-type cells with TMEM208-depleted cells

  • Co-immunoprecipitation studies:

    • Identify TMEM208 interaction partners in the ER translocation machinery

    • Confirm SRP binding using purified components

  • Structural analysis:

    • Use cryo-EM to visualize TMEM208-SRP complexes during different stages of translocation

These approaches should be performed with careful controls including rescue experiments with recombinant TMEM208 protein to confirm specificity .

What developmental phenotypes are associated with TMEM208 deficiency?

Studies in model organisms reveal that TMEM208 deficiency causes significant developmental abnormalities:

In Drosophila with Tmem208 knockout:

  • Approximately 90% lethality during development

  • The 10% of "escapers" that survive to adulthood show:

    • Significantly reduced lifespan

    • Wing and eye developmental defects

    • Defects in planar cell polarity (PCP)

    • Neurological issues including seizure sensitivity

In humans, a child with compound heterozygous variants in TMEM208 presented with:

  • Developmental delay

  • Skeletal abnormalities

  • Multiple hair whorls

  • Cardiac issues

  • Neurological problems including seizures

These overlapping phenotypes between flies and humans suggest TMEM208 functions in fundamental developmental pathways that are evolutionarily conserved .

How does TMEM208 relate to planar cell polarity (PCP) signaling?

TMEM208 has been found to interact with the planar cell polarity pathway through:

  • Direct physical interaction: Tmem208 physically binds to Frizzled (Fz), a key receptor in the PCP pathway

  • Maintenance of receptor levels: Tmem208 is required for maintaining proper levels of Frizzled

  • Phenotypic overlap: Loss of Tmem208 results in wing and eye defects consistent with PCP disruption

The PCP pathway controls the coordinated orientation of cells within a tissue plane, and defects in this pathway cause developmental abnormalities. The connection between TMEM208 and PCP suggests that its role in protein translocation and ER function may be particularly important for proper processing and trafficking of PCP components .

What approaches can be used to generate and validate recombinant chicken TMEM208 protein?

Production strategies for recombinant chicken TMEM208:

Expression SystemTag OptionsPurification MethodValidation Techniques
E. coliHis-tag (N or C-terminal)IMAC chromatographySDS-PAGE, Western blot
Wheat germGST-tagGlutathione affinityMass spectrometry
Mammalian cellsMyc/DDK-tagImmunoaffinityCircular dichroism
HEK293Fc-Avi-tagSize exclusionFunctional assays

For membrane proteins like TMEM208, mammalian expression systems often yield better results for proper folding and post-translational modifications. Validation should include:

  • Purity assessment via SDS-PAGE and silver staining (>90% purity desired)

  • Identity confirmation via mass spectrometry and N-terminal sequencing

  • Secondary structure analysis via circular dichroism

  • Functional verification through binding assays with known partners (e.g., Frizzled)

For chicken TMEM208 specifically, expression in E. coli with an N-terminal His-tag has been successful, yielding protein suitable for antibody production and binding studies .

How can researchers investigate TMEM208's role in ER stress responses?

To investigate TMEM208's involvement in ER stress:

  • ER stress marker analysis:

    • Measure levels of BiP/GRP78 protein via Western blot and immunostaining

    • Assess phosphorylation of eIF2α

    • Monitor Xbp1 splicing using reporter constructs

  • Genetic manipulation approaches:

    • Generate CRISPR-induced null alleles in model organisms

    • Create TMEM208-GFP fusion proteins to track localization during stress

    • Perform RNAi-mediated knockdown in specific tissues

  • Quantitative measurements:

    • In TMEM208-deficient states, a ~1.5-fold increase in BiP protein levels has been observed

    • Elevated p-eIF2α levels indicate activation of the integrated stress response

    • Increased Xbp1 splicing confirms UPR activation

  • Functional rescue experiments:

    • Test whether wild-type TMEM208 expression can rescue ER stress phenotypes

    • Compare with known ER stress variants to establish causality

These methods can be supplemented with transcriptome analysis to identify globally altered stress response genes .

How do mutations in TMEM208 affect its function, and how can these be studied?

Mutations in TMEM208 can significantly impact its function through several mechanisms:

  • Functional impact assessment:

    • Cross-species rescue experiments provide powerful tools to evaluate mutation effects

    • Human TMEM208 variants found in patients fail to rescue Drosophila Tmem208 mutants, indicating they are loss-of-function

    • Proband-specific variants can be reconstructed in model systems to examine functional consequences

  • Experimental approach for mutation analysis:

    • Generate equivalent mutations in recombinant chicken TMEM208

    • Compare wild-type and mutant protein stability, localization, and interaction partners

    • Perform in vitro translocation assays to measure functional impairment

  • Structure-function correlation:

    • Map mutations onto predicted transmembrane topology

    • Assess conservation of affected residues across species

    • Use in silico modeling to predict structural changes

These approaches help distinguish pathogenic from benign variants and establish genotype-phenotype correlations .

What is the relationship between TMEM208 and autophagy regulation?

TMEM208 has been implicated in regulating autophagy, particularly in connection with ER stress:

  • Experimental evidence:

    • Knockdown of TMEM208 in human cell lines increased autophagy

    • TMEM208 may function as a negative regulator of ER stress-induced autophagy

  • Protein interaction network:

    • STRING database analysis reveals TMEM208 connections to autophagy-related proteins including:

      • ATG9A and ATG9B (core autophagy machinery)

      • TMEM59L (autophagy modulator)

  • Methodological approaches to study this connection:

    • Monitor autophagy markers (LC3-II, p62) in TMEM208-deficient models

    • Assess autophagosome formation using fluorescence microscopy

    • Perform epistasis experiments with known autophagy regulators

Understanding this relationship may provide insights into how TMEM208 dysfunction contributes to neurodevelopmental disorders and other pathologies through disrupted proteostasis .

What emerging technologies might advance our understanding of TMEM208 function?

Several cutting-edge approaches show promise for elucidating TMEM208 function:

  • Cryo-electron microscopy:

    • Determine the 3D structure of TMEM208 in complex with SRP and translocation machinery

    • Visualize conformational changes during protein translocation

  • Proximity labeling proteomics (BioID, APEX):

    • Map the dynamic interactome of TMEM208 at the ER membrane

    • Identify temporal changes in protein interactions during development

  • Single-cell multi-omics:

    • Correlate TMEM208 expression with transcriptome and proteome changes

    • Identify cell type-specific functions in diverse tissues

  • Organ-on-chip and organoid models:

    • Study TMEM208 function in physiologically relevant 3D systems

    • Assess tissue-specific requirements in development

  • Base editing and prime editing:

    • Introduce precise mutations to study structure-function relationships

    • Create knockin models for patient-specific variants

These approaches will help bridge the gap between molecular function and developmental consequences of TMEM208 dysfunction .

How might tissue-specific functions of TMEM208 be investigated in chicken development?

To investigate tissue-specific functions of TMEM208 during chicken development:

  • Temporal-spatial expression analysis:

    • Generate a developmental atlas of TMEM208 expression across embryonic stages

    • Use in situ hybridization and immunohistochemistry to map expression patterns

  • Conditional knockout strategies:

    • Apply CRISPR/Cas9 with tissue-specific promoters

    • Use inducible systems to control timing of gene deletion

    • Target tissues showing high expression or developmental phenotypes

  • Ex ovo embryo culture and manipulation:

    • Perform localized RNAi knockdown in developing chicken embryos

    • Use electroporation to introduce expression constructs in specific tissues

  • Transcriptome profiling:

    • Compare expression profiles between original and selected chicken populations

    • Analyze chicken breeds with different growth characteristics to identify TMEM208-associated traits

  • Proteome analysis:

    • Use tandem mass tag (TMT)-LC-MS/MS proteomic strategies to examine protein changes

    • Apply parallel reaction monitoring (PRM) for targeted validation of findings

These approaches can reveal how TMEM208 contributes to chicken-specific developmental processes and potentially agriculturally relevant traits .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.