Recombinant Chicken Transmembrane protein 229B (TMEM229B)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

Recombinant Chicken TMEM229B is produced by expressing the full-length coding sequence of the chicken TMEM229B gene in E. coli systems, typically fused with an N-terminal His tag for purification . Key features include:

PropertySpecification
SpeciesChicken (Gallus gallus)
Expression HostEscherichia coli
TagN-terminal His tag
Protein LengthFull-length (1-167 amino acids)
Molecular Weight~19.5 kDa (predicted)
Purity>90% (SDS-PAGE verified)
StorageLyophilized powder at -20°C/-80°C

The protein sequence begins with MASAEPLTALSRWYLYAIHGY... and retains a conserved DUF1113 domain (residues 87–135), characteristic of transmembrane protein families .

Expression and Purification

The recombinant protein is expressed in E. coli and purified via affinity chromatography using the His tag. Key protocols include:

  • Reconstitution: Dissolved in Tris/PBS-based buffer with 6% trehalose (pH 8.0) .

  • Stability: Repeated freeze-thaw cycles are discouraged; glycerol (5–50%) is added for long-term storage .

Evolutionary Conservation

TMEM229B is highly conserved across vertebrates, with homologs in humans, mice, zebrafish, and chickens . Its structural resemblance to connexin subunits suggests potential roles in membrane transport or intercellular communication .

Clinical Relevance

Human TMEM229B overexpression correlates with malignancies like melanoma, glioblastoma, and carcinomas, though no causal links are established . Its chicken ortholog’s role remains understudied but is hypothesized to involve conserved pathways .

Antibody Development

Anti-TMEM229B antibodies are critical for immunohistochemistry, Western blot, and ELISA . Recombinant chicken TMEM229B serves as an antigen for antibody production, enabling species-specific studies .

Pathway Analysis

TMEM229B is implicated in transmembrane signaling and protein interaction networks, though specific pathways in chickens require further validation .

Disease Modeling

Studies on human TMEM229B highlight its association with Parkinson’s disease risk loci, suggesting potential utility in neurodegenerative disease models .

Challenges and Future Directions

  • Functional Annotation: The DUF1113 domain’s role remains uncharacterized.

  • Species-Specific Studies: Limited data on chicken TMEM229B necessitate comparative analyses with human/mouse models .

  • Therapeutic Potential: Links to cancer and neurodegeneration warrant mechanistic studies .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
TMEM229B; RCJMB04_13p15; Transmembrane protein 229B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-167
Protein Length
full length protein
Species
Gallus gallus (Chicken)
Target Names
TMEM229B
Target Protein Sequence
MAAAEPLTAFSRWYLYAIHGYFCEVMFTAAWEFVVNFNWKFPGVTSVWALFIYGTSILIV EKMYLYLKDKCHILVRCFIYTLWTYLWEFTTGLILRQFNACPWDYSQFDFDFMGLITLEY AIPWFCASFIMEQLVIRNTLRLRFDETAEPGAPTVPVALANGHVKTD
Uniprot No.

Target Background

Database Links

KEGG: gga:423269

UniGene: Gga.8676

Protein Families
TMEM229 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the genetic structure of chicken TMEM229B and how does it compare to mammalian orthologs?

Chicken TMEM229B is a transmembrane protein encoded by a gene located in the chicken genome. While comprehensive characterization is still ongoing, structural analyses indicate that TMEM229B belongs to the TMEM family of proteins that span biological membranes. The protein contains multiple transmembrane domains that anchor it within cellular membranes.

Comparative analysis shows sequence similarity between chicken TMEM229B and mammalian orthologs, with approximately 87% sequence identity to mouse and rat TMEM229B in certain protein regions . This conservation suggests functional importance across species. Unlike some transmembrane proteins with well-defined functions, TMEM229B family members generally have indefinite occupational roles, though studies indicate their expression can be altered in tumor cells compared to normal tissue .

What expression systems are most effective for producing recombinant chicken TMEM229B?

Several expression systems have been employed for recombinant TMEM229B production, each with specific advantages:

Expression SystemAdvantagesConsiderations
Mammalian cell lines (HEK293)Native post-translational modifications, proper protein foldingHigher cost, lower yield
E. coliCost-effective, high yieldMay lack proper folding and post-translational modifications
Chicken-derived cellsSpecies-specific modificationsIntermediate yield
Egg white-based systemsScalable production, high concentration of secreted proteinsComplex purification

The chicken egg-based expression system shows particular promise for recombinant protein production. As demonstrated with other proteins, chickens secrete large amounts of high-concentration proteins from the oviduct, making them efficient bioreactors . This approach has been successfully used for production of recombinant proteins with yields reaching 1.47-4.59 mg/mL in egg white .

What methods are most effective for detecting TMEM229B expression in chicken tissues?

Detection of TMEM229B in chicken tissues requires optimized protocols:

RT-qPCR methodology:

  • Use GAPDH as an internal reaction control, which expresses at higher levels and maintains consistent expression across experimental conditions

  • Tissue preparation: Sample preservation in RNAlater or immediate flash-freezing

  • RNA extraction: TRIzol-based methods with DNase treatment

  • cDNA synthesis: Use high-capacity reverse transcription kits

  • Primer design: Target conserved regions across splice variants

  • Data analysis: Apply 2^(-ΔΔCt) method for relative quantification

Protein detection:

  • Western blotting with species-specific antibodies

  • Immunohistochemistry for tissue localization studies

When comparing expression levels across tissues, proper normalization is critical to account for tissue-specific differences in reference gene expression .

How does TMEM229B expression change under different physiological conditions in chickens?

TMEM229B expression demonstrates notable changes under several physiological conditions:

Experimental diabetic conditions:
Studies in rodent models show that TMEM229B expression, which is highly expressed in untreated control groups, becomes intensely suppressed following streptozotocin (STZ) treatment, coinciding with upregulation of apoptotic genes like p53, BAX, and Caspase 3 . This suggests potential involvement in metabolic pathways or cell survival mechanisms.

Environmental toxicants:
Exposure to environmental chemicals like tetrachlorodibenzodioxin has been shown to decrease TMEM229B expression in some studies while increasing it in others, suggesting context-dependent regulation .

These expression patterns indicate that TMEM229B may play roles in hormone signaling pathways and stress responses, though the precise mechanisms require further investigation.

What are the optimal methodologies for genetic modification of the TMEM229B locus in chicken genome?

Several genetic modification techniques have been developed for targeting the TMEM229B locus:

CRISPR/Cas9 system for TMEM229B:

  • Design of guide RNAs: Target 5' constitutive exons for maximum knockout efficiency

  • Delivery methods: Lentiviral vectors have shown success for stable integration

  • Validation: Combine genomic PCR, RT-qPCR, and Western blotting for comprehensive confirmation

The CRISPR/Cas9 system enables the identification and precise cleavage of specific genomic regions through guide RNA (gRNA) sequences. For TMEM229B modification in human cells, pools of 3 plasmids encoding Cas9 nuclease and target-specific 20 nt gRNAs have been developed to ensure maximum knockout efficiency . Similar approaches can be adapted for chicken cells.

Site-specific recombination technology:
Targeted genome recombination has been successfully applied in chicken models using recombinase-mediated gene cassette exchange (RMCE) technology. For example, transgenic chicken lines with Flipase (Flp) recognition target (FRT) pairs integrated in the chicken genome have been established using piggyBac transposition . This technology could be adapted for TMEM229B:

  • Establish FRT pairs flanking the TMEM229B locus

  • Create donor vectors carrying modified TMEM229B sequences

  • Introduce Flp recombinase to facilitate precise exchange

This approach allows for specific gene regulation through cis-element insertion and customized expression of functional proteins at predicted levels without epigenetic influence .

How can TMEM229B be studied in relation to apoptotic pathways in chicken cells?

TMEM229B's relationship to apoptotic pathways can be investigated through:

Experimental approaches:

  • Gene expression correlation studies:

    • Simultaneous measurement of TMEM229B and apoptotic markers (BAX, Caspase 3, p53)

    • Statistical analysis of co-expression patterns

  • Functional studies:

    • TMEM229B overexpression or knockdown followed by apoptosis induction

    • Assessment of apoptotic marker changes, including:

      • Flow cytometry with Annexin V/PI staining

      • Caspase activity assays

      • TUNEL assays for DNA fragmentation

Research in mammalian models has identified a relationship between TMEM229B expression and apoptotic pathways. In STZ-induced diabetic rats, TMEM229B expression was intensely suppressed while apoptotic genes (p53, BAX, Caspase 3) were upregulated . This inverse relationship suggests TMEM229B might play a role in cellular survival pathways, though direct mechanistic studies in chicken cells are needed to confirm similar functions.

What are the implications of TMEM229B polymorphisms for chicken production traits and disease susceptibility?

TMEM229B polymorphisms may have significant implications for chicken production traits and disease susceptibility, though research specifically on TMEM229B is limited. Approaches to study this include:

SNP identification and analysis:

  • T-ARMS PCR methods have been adapted for detecting SNPs in chicken genes

  • Specific protocols require optimization of primer ratios (inner:outer primers at 10:1 pmol/μM), DNA template concentration (100 ng/μL), and appropriate annealing temperatures

Association studies:

  • Correlate identified polymorphisms with:

    • Growth traits (body weight, feed conversion)

    • Immune responses to pathogens

    • Reproductive performance

Studies on other transmembrane genes have demonstrated their importance in production traits. For example, transversion mutations in the LEPR gene have been detected in various chicken populations (F1 Kambro hens 80%, F2 Kambro roosters 20%, Broiler Cobb 500 hens 75%) and associated with chicken body weight gain and egg productivity .

The application of environmental niche modeling (ENM) integrated with genome-environmental association analyses has proven valuable for studying environmental adaptation in chicken populations . This approach could be applied to TMEM229B to understand its role in adaptation to different environmental stressors.

How does recombinant TMEM229B interact with the Wnt signaling pathway in chicken cells?

Based on protein interaction data, TMEM229B may have functional relationships with Wnt signaling components:

Research methodologies:

  • Co-immunoprecipitation assays:

    • Pull-down of TMEM229B followed by Western blotting for Wnt pathway components

    • Reciprocal co-IP to confirm interactions

  • Functional pathway analysis:

    • TOPFlash/FOPFlash reporter assays to measure canonical Wnt activity

    • β-catenin nuclear localization studies following TMEM229B manipulation

  • Gene expression studies:

    • qPCR analysis of Wnt target genes after TMEM229B overexpression/knockdown

Protein interaction data indicates TMEM229B may be functionally related to TMEM131L, which antagonizes canonical Wnt signaling by triggering lysosome-dependent degradation of Wnt-activated LRP6 . This suggests TMEM229B might also play a role in Wnt pathway regulation, though direct evidence in chicken cells is currently lacking.

GSEA functional enrichment analysis of another TMEM family member, TMEM229B, has shown associations with various pathways including cell adhesion molecules, chemokine signaling pathway, and hematopoietic cell lineage , suggesting broad regulatory functions that could indirectly impact Wnt signaling.

What are the best approaches for studying the role of TMEM229B in immune responses in chickens?

To investigate TMEM229B's role in chicken immune responses:

Experimental design options:

  • Immune challenge studies:

    • Expose chickens to pathogens or immune stimulants (LPS, poly I:C)

    • Monitor TMEM229B expression changes in immune tissues

    • Correlate with cytokine production and immune cell activation

  • Cell-specific expression analysis:

    • Single-cell RNA sequencing of immune populations

    • Flow cytometry to identify TMEM229B-expressing immune cell subtypes

  • Functional genomics:

    • CRISPR-mediated knockout in chicken immune cells

    • Assessment of immune response parameters:

      ParameterMethodology
      Cytokine productionELISA, qPCR
      Cell migrationTranswell assays
      PhagocytosisFluorescent bead uptake
      Antibody productionELISA

GSEA functional enrichment indicates that TMEM229B expression may be related to immune responses, including "GRAFT VS. HOST DISEASE" and "CHEMOKINE SIGNALING PATHWAY" . Additionally, studies on TMEM229B in cancer contexts have shown associations with immune scores, suggesting it may influence the tumor immune microenvironment . These findings point to potential immunomodulatory functions that warrant investigation in chicken immune systems.

How can transgenic chicken models be utilized to study TMEM229B function in vivo?

Transgenic chicken models offer powerful tools for studying TMEM229B function:

Development strategies:

  • Gene-targeted models using CRISPR/Cas9:

    • Design targeting constructs specific to chicken TMEM229B locus

    • Microinjection into newly fertilized eggs or primordial germ cells

    • Screening of chimeric offspring and breeding to establish stable lines

  • Tissue-specific expression systems:

    • Utilize oviduct-specific promoters like Ovalbumin for female-specific expression

    • Employ ubiquitous promoters (e.g., chicken β-actin) for whole-body expression

  • Inducible expression systems:

    • Tetracycline-controlled transcriptional activation

    • Heat shock protein promoters for temporal control

The successful development of gene-targeted chicken models has been demonstrated for various applications. For example, researchers have produced transgenic chickens with FRT pairs in the genome mediated by piggyBac transposition . Similar approaches could be applied to TMEM229B.

For protein production purposes, the chicken oviduct system has proven highly effective. Studies show that when human recombinant proteins are expressed under the control of the endogenous Ovalbumin promoter, they can accumulate at concentrations of 1.47-4.59 mg/mL in egg white . This approach could be valuable for studying the effects of TMEM229B overexpression or for producing modified versions of the protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.