Recombinant Chicken Transmembrane protein 231 (TMEM231)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Chicken Transmembrane Protein 231 (TMEM231)

Recombinant Chicken Transmembrane Protein 231 (TMEM231) is a protein produced through recombinant DNA technology, where the gene encoding TMEM231 is inserted into a host organism such as yeast, E. coli, or mammalian cells. This allows for the large-scale production of the protein for research and potential therapeutic applications. TMEM231 is a critical component of the transition zone in primary cilia, playing a crucial role in maintaining ciliary structure and function .

Production and Sources of Recombinant Chicken TMEM231

Recombinant Chicken TMEM231 is available in various forms, depending on the host organism used for its production:

Production SourceDescription
YeastHigh purity, produced in yeast cells .
E. coliProduced in E. coli bacteria, available with or without biotin conjugation .
BaculovirusProduced using the baculovirus expression system in insect cells .
Mammalian CellsProduced in mammalian cell lines for high fidelity to native protein structure .

Biological Function of TMEM231

TMEM231 is essential for the formation and function of the transition zone in primary cilia. It interacts with other components of the Meckel syndrome (MKS) complex, such as B9d1 and Mks1, to regulate the localization of ciliary membrane proteins . Mutations in the TMEM231 gene have been associated with ciliopathies like Meckel syndrome and orofaciodigital syndrome type 3 .

Research Findings and Applications

Research on TMEM231 has primarily focused on its role in ciliopathies. Studies have shown that mutations in TMEM231 disrupt ciliary function, leading to developmental abnormalities such as polydactyly and kidney cysts . The recombinant protein can be used in studies to understand the molecular mechanisms underlying these conditions and to explore potential therapeutic strategies.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, offered as a guideline for your reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its inclusion.
Synonyms
TMEM231; Transmembrane protein 231
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-320
Protein Length
full length protein
Species
Gallus gallus (Chicken)
Target Names
TMEM231
Target Protein Sequence
MAGVELFSHPALHTRYRAGLCSAAALALLLIAVLTYVPPLLVAYRSHGFWLKQSAYREQP TVRFRYELLFVATTGPGPGSFLAWSTFPAFNRLQEDRLRVPLLSTREEDKNQDGKMDQLH FKLELPLQPTEHVVGVQLILIFSYQLYRMSTFVMQSMAFLQFFSPVPGSQLYANGDLKLN QRQLLNHCGLDTRYNVSVVNGTSPFASDYDLKNIIAAYRDRNVTTVFSDSNPIWMTGRGA NTPFIVNATIRYPVEVILYQPGFWETIKFAWIQYVSILLIFLWVFGRIKMFVFQNQVFAT TPVSPVLPLSPVLSYKQHQP
Uniprot No.

Target Background

Function
Transmembrane component of the tectonic-like complex, a complex localized at the transition zone of primary cilia. This complex functions as a barrier, preventing transmembrane protein diffusion between cilia and the plasma membrane. TMEM231 is essential for ciliogenesis and sonic hedgehog (SHH) signaling.
Database Links
Protein Families
TMEM231 family
Subcellular Location
Cell projection, cilium membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.