Recombinant Chicken Transmembrane protein 41B (TMEM41B)

Shipped with Ice Packs
In Stock

Description

Functional Roles of TMEM41B

TMEM41B is a multifunctional protein with roles spanning viral infection, lipid regulation, and calcium dynamics.

Viral Infection and Lipid Metabolism

TMEM41B is an interferon-stimulated gene (ISG) that promotes viral replication by regulating lipid synthesis:

  • Pseudorabies Virus (PRV): TMEM41B knockdown in chicken cells reduces viral entry by disrupting lipid homeostasis and clathrin-coated pit dynamics .

  • Coronaviruses: CRISPR screens identify TMEM41B as essential for TGEV (transmissible gastroenteritis virus) internalization and replication organelle formation in porcine cells, suggesting conserved mechanisms across species .

  • Lipid Scramblase Activity: TMEM41B may regulate membrane lipid composition, facilitating viral budding .

Calcium Homeostasis

In murine T cells, TMEM41B functions as an ER calcium (Ca²⁺) release channel:

  • ER Ca²⁺ Regulation: Prevents ER Ca²⁺ overload, maintaining metabolic quiescence .

  • Mechanism: Concentration-dependent Ca²⁺ release, with channel activity confirmed via single-channel recordings of purified TMEM41B .

Applications in Research

Recombinant Chicken TMEM41B is utilized in diverse experimental approaches:

ApplicationMethodPurpose
ELISAChicken TMEM41B-specific ELISA kits Quantify TMEM41B protein levels in avian samples.
CRISPR ScreensGenome-wide KO screens in porcine cells Identify TMEM41B as a host factor for coronaviruses.
Viral ReplicationKnockdown/overexpression in PK-15 cells Study TMEM41B’s role in PRV entry and lipid-dependent infection.
Structural StudiesPurified recombinant protein for electrophysiology Characterize Ca²⁺ channel activity and gating mechanisms.

Viral Dependency on TMEM41B

  • PRV Infection: TMEM41B knockdown reduces PRV entry by 30% and viral titer by >50% in chicken cells .

  • TGEV Replication: TMEM41B KO cells show impaired viral RNA replication and double-membrane vesicle formation .

Lipid Metabolism

  • Cholesterol and Sphingolipids: TMEM41B regulates lipid synthesis enzymes (e.g., HMGCR, SMS1), critical for viral membrane remodeling .

  • Clathrin-Coated Pits: TMEM41B knockdown disrupts CCP dynamics, impairing PRV internalization .

Calcium Regulation

  • ER Ca²⁺ Release: TMEM41B-deficient T cells exhibit ER Ca²⁺ overload, activating pro-survival pathways (JAK-STAT, AKT-mTOR) .

  • Therapeutic Implications: Targeting TMEM41B may modulate ER Ca²⁺ to suppress viral replication or enhance immune responses .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we currently have in stock. However, if you have a specific format preference, please indicate it in your order notes, and we will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a reference for your own formulations.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, liquid form exhibits a shelf life of 6 months at -20°C/-80°C. Lyophilized form maintains its stability for 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
TMEM41B; RCJMB04_25c20; Transmembrane protein 41B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-269
Protein Length
full length protein
Species
Gallus gallus (Chicken)
Target Names
TMEM41B
Target Protein Sequence
MAQRRAAAESARHQRLLEGKAQAEGGSARTSLLILVSIFTIAAFLMFLVYKNFPQLSEEE GKCIKIPRDMDDAKALGKVLSKYKDTFYVQVLVAYFATYVFLQTFAIPGSIFLSILSGFL YPFPLALFLVCLCSGLGASFCYMLSYLVGRPVVYKYLTEKAVKWSEQVERHREHLINYII FLRITPFLPNWFINITSPVINVPLKVFFIGTFLGVAPPSFVAIKAGTTLYQLTTAGEAVS WNSLFVLMILAILSILPALFQKKLKQKFE
Uniprot No.

Target Background

Function
Transmembrane protein 41B (TMEM41B) is a phospholipid scramblase involved in lipid homeostasis and membrane dynamics. It exhibits phospholipid scramblase activity towards cholesterol and phosphatidylserine, along with phosphatidylethanolamine and phosphatidylcholine. TMEM41B plays a crucial role in autophagosome formation, participating in the early stages of autophagosome biogenesis at the endoplasmic reticulum (ER) membrane. By reequilibrating the leaflets of the ER as lipids are extracted by ATG2 (ATG2A or ATG2B), it facilitates autophagosome assembly. Beyond autophagy, TMEM41B is implicated in other processes requiring phospholipid scramblase activity. It is essential for normal motor neuron development.
Database Links
Protein Families
TMEM41 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Endomembrane system.

Q&A

What is TMEM41B and what are its primary functions in cellular physiology?

TMEM41B is an endoplasmic reticulum (ER)-resident multiple-spanning membrane protein initially characterized for its roles in autophagy. Recent research has identified TMEM41B as a novel concentration-dependent ER Ca²⁺ release channel that plays a critical role in preventing ER Ca²⁺ overload . Functionally, TMEM41B exhibits phospholipid scramblase activity and is involved in lipid metabolism and viral infection regulation . In T cells specifically, TMEM41B-mediated ER Ca²⁺ release serves as a pivotal determinant governing metabolic quiescence and responsiveness of naive T cells .

To study TMEM41B's function, researchers typically employ knockout models using CRISPR/Cas9 technology followed by calcium imaging techniques to measure ER Ca²⁺ levels. For example, TMEM41B-deficient cells show increased ER Ca²⁺ levels measurable using ER Ca²⁺ sensors like G-CEPIA1er .

How can researchers generate and validate TMEM41B knockout models?

Generating TMEM41B knockout models involves:

  • CRISPR/Cas9 genome editing: Design sgRNAs targeting the TMEM41B locus and co-transfect with Cas9 expression plasmids into target cells

  • Selection strategy: Apply antibiotic selection (e.g., puromycin for initial selection, followed by neomycin for selecting cells with successful integration)

  • Validation methods:

    • PCR genotyping to confirm genomic modification

    • Western blotting to verify protein absence

    • Functional validation by measuring ER Ca²⁺ levels using calcium sensors

    • Phenotypic characterization by assessing cellular processes known to involve TMEM41B (e.g., autophagy, Ca²⁺ homeostasis)

For conditional knockout models in specific cell types (e.g., T cells), researchers can use the Cre-loxP system as demonstrated by crossing Tmem41b-floxed mice with Cd4-Cre transgenic mice to achieve T cell-specific deletion .

What experimental approaches can be used to measure TMEM41B's Ca²⁺ channel activity?

Several complementary methods can measure TMEM41B-mediated calcium dynamics:

  • Genetically-encoded calcium indicators (GECIs):

    • G-CEPIA1er for direct ER Ca²⁺ monitoring in live cells

    • Data analysis involves measuring fluorescence intensity before and after treatments

  • Store-operated calcium entry (SOCE) assays:

    • Treat cells with thapsigargin (SERCA inhibitor) to deplete ER Ca²⁺

    • Measure subsequent Ca²⁺ influx which correlates with initial ER Ca²⁺ levels

    • TMEM41B-deficient cells typically show blunted SOCE and increased baseline ER Ca²⁺

  • Electrophysiological approaches:

    • Patch-clamp recording to directly measure channel activity

    • Often combined with mutagenesis studies to identify critical residues for channel function

  • Calcium flux analysis using flow cytometry:

    • Particularly useful for immune cells like T cells

    • Can be combined with cell surface marker analysis for phenotypic correlation

How does TMEM41B deficiency affect T cell metabolism and immune function?

TMEM41B deficiency in T cells leads to a cascade of metabolic and functional changes:

  • Metabolic activation in naive state:

    • Increased oxygen consumption rate (OCR) and extracellular acidification rate (ECAR)

    • Enhanced mitochondrial mass and membrane potential

    • Elevated reactive oxygen species (ROS) production

  • Altered receptor expression and signaling:

    • Upregulation of IL-2 receptor alpha (CD25) and IL-7 receptor alpha (CD127)

    • Increased basal signaling through JAK-STAT, AKT-mTOR, and MAPK pathways

    • Downregulation of CD5, a suppressor of TCR signaling

  • Immunological consequences:

    • Reduced activation threshold of T cells

    • Attenuated tolerance (resistance to anti-CD3-induced deletion)

    • Heightened T cell responses during infections

This creates a unique phenotype described as "metabolically activated yet immunologically naive" . Researchers investigating these effects should employ comprehensive metabolic profiling (e.g., Seahorse analyzer), signaling pathway analysis, and in vivo immune response models.

What are the key amino acid residues responsible for TMEM41B's Ca²⁺ channel activity?

Research has identified specific acidic residues critical for TMEM41B's calcium channel function:

  • The D91/93/94A mutation in TMEM41B significantly reduces its Ca²⁺ channel activity

  • Rescue experiment methodology:

    • Generate wild-type and D91/93/94A mutant TMEM41B constructs

    • Transduce these constructs into TMEM41B-deficient T cells

    • Measure whether wild-type TMEM41B, but not the D91/93/94A mutant, can reverse phenotypes associated with TMEM41B deficiency

    • Research shows that only wild-type TMEM41B, not the D91/93/94A mutant, reverses the upregulation of CD25 and CD127, increased AKT and STAT5 signaling, and enlarged cell size of TMEM41B-deficient T cells

These findings demonstrate that the calcium channel activity of TMEM41B is directly responsible for its physiological functions in T cells.

How does TMEM41B interact with the mTORC1 pathway to regulate T cell metabolism?

TMEM41B deficiency leads to activation of the mTORC1 pathway, contributing to metabolic alterations in T cells:

  • Experimental approach to test mTORC1 involvement:

    • Generate double knockout mice by crossing Cd4-Cre Tmem41b-flox mice with Rptor-flox mice (depleting RAPTOR, the defining component of mTORC1)

    • Analyze cell size, metabolic parameters, and signaling pathways

  • Key findings:

    • RAPTOR deficiency largely reverses the enlarged size of TMEM41B-deficient T cells

    • Increased OCR and ECAR in TMEM41B-deficient T cells are partially mitigated by RAPTOR deficiency

    • Incomplete rescue suggests other pathways (e.g., STAT5, ERK) also contribute to the metabolic phenotype

This methodological approach of genetic epistasis experiments helps delineate the relative contribution of different signaling pathways to the TMEM41B-deficient phenotype.

What is the relationship between TMEM41B's function in autophagy and its calcium channel activity?

While TMEM41B was initially discovered as an autophagy regulator through genome-wide CRISPR screens , the relationship between its autophagy function and calcium channel activity remains an active area of investigation:

  • Experimental approaches to investigate this relationship:

    • Compare autophagy markers in cells expressing wild-type versus D91/93/94A mutant TMEM41B

    • Use calcium chelators or calcium ionophores to manipulate ER calcium levels and measure effects on autophagy

    • Conduct proteomics analysis to identify TMEM41B-interacting proteins involved in both calcium regulation and autophagy

  • Hypothetical mechanisms connecting these functions:

    • ER calcium levels may directly affect autophagosome formation

    • Calcium signaling could regulate activation of autophagy-related kinases

    • TMEM41B's lipid scramblase activity may affect both calcium transport and autophagosome membrane formation

How can CRISPR/Cas9 be utilized to generate recombinant TMEM41B in chicken systems?

Based on studies with recombinant protein production in chickens, the following methodology can be applied to TMEM41B:

  • Plasmid construction:

    • sgRNA/Cas9 plasmid targeting the desired integration site (e.g., ovalbumin locus)

    • Donor plasmid containing:

      • 5' homology arm (~2.8 kb of DNA upstream of integration site)

      • TMEM41B cDNA sequence with appropriate signal peptide

      • Selection marker (e.g., neomycin resistance gene)

      • 3' homology arm (~3.2 kb)

  • Cell manipulation:

    • Transfect chicken primordial germ cells (PGCs) with both plasmids

    • Select transfected cells using antibiotics (e.g., puromycin followed by neomycin)

    • Expand selected cell populations

  • Generation of germline chimeras:

    • Transplant modified PGCs into the bloodstream of recipient chicken embryos

    • Raise chimeric roosters and cross with wildtype hens

    • Identify positive offspring through PCR genotyping

  • Protein expression analysis:

    • Collect samples (e.g., egg whites if using ovalbumin locus)

    • Analyze protein expression using SDS-PAGE, Western blotting, and functional assays

What imaging techniques are most effective for studying TMEM41B localization and dynamics?

Multiple imaging approaches can be employed to study TMEM41B:

  • Fluorescent protein tagging:

    • Generate TMEM41B fusion constructs with fluorescent proteins (e.g., GFP, mCherry)

    • Validate that tagging doesn't interfere with function through rescue experiments

    • Use confocal microscopy for high-resolution localization studies

  • Super-resolution microscopy:

    • Structured illumination microscopy (SIM) or stimulated emission depletion (STED) for detailed subcellular localization

    • Single-molecule localization microscopy for protein clustering analysis

  • Co-localization studies:

    • Combine TMEM41B labeling with markers for specific ER subdomains

    • Quantify co-localization using Pearson's correlation coefficient or Manders' overlap coefficient

  • Live-cell imaging:

    • Use photoactivatable or photoconvertible fluorescent protein tags to track TMEM41B movement

    • Combine with calcium indicators to correlate localization with calcium flux events

  • Proximity labeling:

    • Employ BioID or APEX2 fusion constructs to identify proteins in close proximity to TMEM41B

What experimental designs can best determine the effect of TMEM41B on immune responses in vivo?

Several experimental approaches can assess TMEM41B's role in immune function:

  • T cell tolerance assays:

    • Inject anti-CD3 antibody to induce T cell deletion in vivo

    • Compare wild-type and TMEM41B-deficient T cell survival rates

    • Analyze remaining T cell populations by flow cytometry

  • Infection models:

    • Challenge mice with viral or bacterial pathogens

    • Measure T cell expansion, cytokine production, and pathogen clearance

    • Compare responses between wild-type and TMEM41B-deficient animals

  • Autoimmunity assessment:

    • Monitor mice for spontaneous autoimmunity development

    • Employ induced autoimmunity models (e.g., EAE for multiple sclerosis)

    • Analyze autoantibody production and tissue inflammation

  • Adoptive transfer experiments:

    • Transfer wild-type or TMEM41B-deficient T cells into lymphopenic hosts

    • Assess homeostatic proliferation and potential development of autoimmunity

    • Measure recipient responses to immune challenges

How can structural studies advance our understanding of TMEM41B function?

Structural biology approaches hold significant promise for TMEM41B research:

  • Cryo-electron microscopy:

    • Determine high-resolution structure of TMEM41B in different conformational states

    • Identify calcium binding sites and channel pore

    • Visualize interactions with regulatory proteins

  • Structure-guided mutagenesis:

    • Beyond the identified D91/93/94 residues, systematically mutate potential functional regions

    • Create a comprehensive structure-function map of TMEM41B

  • Molecular dynamics simulations:

    • Model calcium movement through the TMEM41B channel

    • Predict effects of mutations or drug binding

    • Simulate lipid-protein interactions given TMEM41B's scramblase activity

  • Drug design applications:

    • Use structural information to identify potential binding pockets

    • Develop small molecules that could modulate TMEM41B function

    • Design peptides that mimic or block interaction surfaces

What are the potential applications of TMEM41B research in viral immunity?

Given TMEM41B's identification as a pan-flavivirus and pan-coronavirus host factor , several research directions emerge:

  • Mechanism investigation:

    • Determine how TMEM41B supports viral replication

    • Investigate whether its calcium channel activity or lipid scramblase function is more important for viral lifecycle

    • Create viral mutants that bypass TMEM41B dependency

  • Therapeutic targeting:

    • Screen for small molecules that modulate TMEM41B function

    • Design peptide inhibitors based on viral protein-TMEM41B interactions

    • Develop strategies to temporarily downregulate TMEM41B expression

  • Cross-species comparison:

    • Analyze TMEM41B sequence and function across species with different viral susceptibilities

    • Identify natural variants that confer resistance to viral infection

    • Engineer resistant variants for potential therapeutic applications

  • Combination approaches:

    • Test TMEM41B targeting alongside other antiviral strategies

    • Determine potential synergies with immune-enhancing therapies

    • Evaluate possible side effects on normal cellular functions

How might modulating TMEM41B function impact T cell-based immunotherapies?

The role of TMEM41B in T cell metabolism and activation suggests several therapeutic applications:

  • CAR-T cell engineering:

    • Investigate whether transient TMEM41B inhibition could enhance CAR-T cell function

    • Test if TMEM41B modulation affects persistence of adoptively transferred T cells

    • Determine optimal timing for TMEM41B targeting during manufacturing process

  • Cancer immunotherapy enhancement:

    • Explore whether TMEM41B inhibition lowers T cell activation threshold against tumor antigens

    • Test combination approaches with checkpoint inhibitors

    • Assess potential for increasing tumor-infiltrating lymphocyte activity

  • Autoimmunity management:

    • Develop methods to increase TMEM41B function to potentially raise T cell activation threshold

    • Investigate TMEM41B enhancement as a strategy to promote T cell tolerance

    • Explore tissue-specific delivery approaches to minimize systemic effects

  • Safety considerations:

    • Thoroughly assess potential autoimmune risks of TMEM41B inhibition

    • Develop reversible targeting strategies

    • Identify biomarkers predictive of response or adverse events

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.