Recombinant Chicken Transmembrane protein 68 (TMEM68)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag type, please inform us, and we will prioritize its inclusion.
Synonyms
TMEM68; RCJMB04_19b17; Transmembrane protein 68
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-332
Protein Length
full length protein
Species
Gallus gallus (Chicken)
Target Names
TMEM68
Target Protein Sequence
MIGSNESSTEGPIPTSYLSFLAYLLGEWTGVEHTEDYLSYGAYLSWVLFPLAIVFILPVA IFFFCFNTSLLLLHIYKRRKNGFNEGHSGDVWYGAKEMLVNLWDGHGRVWHGYELHGDEN IPEVPALIVFYHGASPVDYLYFMARLLIRRKRYCHVVADHFVFRLPGLKMFIEVLGVMHG PKEVCVSALKKGYLLAISPGGVREALFSDETYAIMWGNRKGFAQVAIDAKVPIIPMFTQN VREGIRTLGGIKIFRKLYERIRLPIVPMYGWFPVKFRTFIGEPIPYDPNITAEELTAKTK AALQALITKHQKIPGNILRALMERFQTRQKED
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is TMEM68 and what is its primary function in cellular metabolism?

TMEM68 (Transmembrane protein 68) is an evolutionarily conserved integral membrane protein that functions as an acyltransferase in glycerolipid metabolism. Recent research has demonstrated that TMEM68 acts as both a monoacylglycerol acyltransferase (MGAT) and diacylglycerol acyltransferase (DGAT), promoting triacylglycerol (TAG) synthesis and lipid droplet formation . The protein is primarily localized to the endoplasmic reticulum (ER) membrane and contributes to cellular TAG storage independently of canonical DGAT1 and DGAT2 enzymes . These enzymatic activities position TMEM68 as an important player in lipid metabolism, particularly in energy storage and membrane lipid composition regulation.

How does recombinant chicken TMEM68 compare to mammalian orthologs in terms of sequence conservation and functional domains?

While specific comparative analyses of chicken TMEM68 versus mammalian orthologs are not extensively documented in the provided research, general patterns of conservation can be inferred. TMEM68 is described as an evolutionarily conserved protein, suggesting significant sequence and functional similarity across species . The conservation likely extends to functional domains, particularly the active sites responsible for acyltransferase activity. Mammalian TMEM68 contains conserved active sites essential for its MGAT and DGAT activities, as demonstrated in functional studies . Researchers working with chicken TMEM68 should expect similar catalytic domains to be present, though species-specific variations in regulatory elements or substrate preferences may exist. Sequence alignment tools would be valuable for identifying the precise degree of conservation between chicken TMEM68 and its mammalian counterparts.

What expression systems are commonly used for producing recombinant chicken TMEM68?

Based on commercial sources, recombinant chicken TMEM68 is predominantly produced using E. coli expression systems . This bacterial expression platform offers advantages for producing reasonable quantities of the protein with N-terminal His-tagging for purification purposes. The expressed protein typically includes the full-length sequence (1-334 amino acids) and is provided as a lyophilized powder that requires reconstitution for experimental use . While E. coli represents a cost-effective expression system, researchers should consider that this prokaryotic system lacks the post-translational modification machinery present in eukaryotic cells, which might affect certain aspects of protein function or interaction studies. For studies specifically requiring post-translational modifications, mammalian or insect cell expression systems might represent alternatives, though these are not as commonly documented for chicken TMEM68 production.

What purification strategies yield the highest activity retention for recombinant chicken TMEM68?

Purification of recombinant chicken TMEM68 typically leverages the N-terminal His-tag for affinity chromatography . To maximize activity retention, researchers should consider the following methodological approach: First, use gentle lysis conditions that preserve membrane protein integrity, possibly employing detergents that maintain the native conformation of transmembrane domains. Second, conduct affinity purification using immobilized metal affinity chromatography (IMAC) with optimized imidazole gradients to reduce non-specific binding while maximizing target protein recovery. Third, include stabilizing agents such as glycerol (5-50%) in storage buffers to prevent protein aggregation and maintain enzymatic activity . The purified protein should be stored in aliquots at -20°C/-80°C to avoid repeated freeze-thaw cycles, which can substantially reduce activity. When working with the protein, reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL is recommended, followed by activity assays to verify functional integrity before experimental use .

How can researchers assess the enzymatic activities of recombinant chicken TMEM68 in vitro?

To evaluate the enzymatic activities of recombinant chicken TMEM68, researchers can adapt the in vitro assays used for mammalian TMEM68 characterization. These assays test both MGAT and DGAT activities through the following methodology: First, prepare reaction mixtures containing appropriate substrates—monoacylglycerol or diacylglycerol, along with acyl-CoA donors, typically radioactively labeled for detection sensitivity (e.g., [14C]oleoyl-CoA). Second, initiate reactions by adding purified recombinant TMEM68 in appropriate buffer conditions (pH ~7.4, physiological salt concentrations). Third, after incubation (typically 5-30 minutes at 37°C), terminate reactions and extract lipids using organic solvents. Fourth, separate reaction products using thin-layer chromatography and quantify labeled lipid products through scintillation counting or phosphorimaging . For confirmatory analyses, site-directed mutagenesis of conserved active sites provides important controls to verify enzyme specificity. Additionally, researchers can assess activity indirectly through complementation studies in cells where endogenous DGAT activities have been knocked out, measuring restoration of triacylglycerol synthesis and lipid droplet formation through microscopy and lipidomic approaches .

What cellular models are most appropriate for studying chicken TMEM68 function in a heterologous expression system?

For studying chicken TMEM68 function in heterologous systems, researchers should consider several cellular models based on experimental objectives. For basic functional characterization, mammalian cell lines like HEK293, COS-7, or CHO cells provide robust expression of exogenous proteins and compatibility with various imaging and biochemical techniques. To study TMEM68's role in lipid metabolism specifically, hepatic cell lines (HepG2, Huh7) or adipocyte models (3T3-L1) offer relevant metabolic contexts with active lipid synthesis pathways . For neural-specific functions, given TMEM68's high expression in brain tissue, neuroblastoma cell lines (SH-SY5Y) or glioblastoma cells would be appropriate, as used in recent studies . To assess TMEM68's contribution distinct from other acyltransferases, DGAT1/DGAT2 double-knockout cell lines provide valuable backgrounds to observe TMEM68-specific effects . For more physiologically relevant contexts, primary chicken hepatocytes or neural cells could be used, though these present greater technical challenges. Regardless of the chosen model, researchers should validate appropriate expression and localization of chicken TMEM68 to the endoplasmic reticulum using immunofluorescence or subcellular fractionation techniques before conducting functional studies.

What are the recommended storage and handling procedures to maintain optimal activity of recombinant chicken TMEM68?

To maintain optimal activity of recombinant chicken TMEM68, researchers should implement specific storage and handling protocols. Upon receipt, store the lyophilized protein powder at -20°C/-80°C and avoid exposure to repeated temperature fluctuations . For reconstitution, briefly centrifuge the vial to collect all material at the bottom before opening. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL, and add glycerol to a final concentration of 5-50% (with 50% being optimal for long-term storage) to prevent freeze-induced denaturation . Aliquot the reconstituted protein into single-use volumes to avoid repeated freeze-thaw cycles, which significantly diminish activity. Working aliquots can be stored at 4°C for up to one week, while long-term storage requires -20°C/-80°C conditions . Before experimental use, allow frozen aliquots to thaw completely on ice rather than at room temperature to minimize protein degradation. For enzymatic assays, optimize buffer conditions based on precedent studies of TMEM68 activity, typically employing neutral pH (7.0-7.5) and physiological salt concentrations. Document batch-to-batch variation by including activity assays with standard substrates as quality control measures for each new protein preparation.

How does TMEM68 interact with other enzymes in the glycerolipid synthesis pathway, and what methods can detect these interactions?

TMEM68 functions within the complex network of glycerolipid metabolism, where research suggests both direct and indirect interactions with other pathway enzymes. To investigate these interactions, researchers can employ multiple complementary approaches. Proximity labeling techniques such as BioID or APEX can identify proteins in close spatial proximity to TMEM68 within the ER membrane. Co-immunoprecipitation followed by mass spectrometry can detect stable protein complexes containing TMEM68 and potential interacting partners such as other acyltransferases or lipid metabolism enzymes. For functional interactions, researchers can use genetic approaches including overexpression or knockdown of TMEM68 combined with activity measurements of other pathway enzymes to detect compensatory mechanisms or regulatory relationships . Recent research has shown that TMEM68 promotes TAG synthesis independently of canonical DGAT1 and DGAT2 enzymes, suggesting parallel rather than sequential pathway operation . Additionally, TMEM68 expression influences levels of lipogenic genes including DGATs and fatty acid synthesis-related genes, indicating potential transcriptional regulatory feedback . Lipidomic analyses before and after perturbation of TMEM68 levels can reveal shifts in substrate utilization patterns that suggest competition or cooperation with other lipid metabolism enzymes in cellular contexts.

What is the tissue-specific expression pattern of TMEM68 in chicken compared to other species, and how might this inform functional specialization?

While comprehensive chicken-specific TMEM68 expression data is limited in the provided research, comparative analysis with other species provides valuable insights. In mice, TMEM68 transcripts are most abundantly expressed in brain tissue , suggesting neuronal specialization. For chicken-specific expression patterns, researchers should conduct quantitative PCR or RNA sequencing across a panel of tissues including brain, liver, adipose, muscle, and reproductive organs. This approach would reveal whether chicken TMEM68 maintains the brain-predominant expression seen in mammals or exhibits avian-specific expression patterns. Understanding tissue distribution is crucial for interpreting functional specialization; high neural expression suggests roles in brain lipid metabolism, which is particularly relevant given the importance of specific lipid compositions for neuronal function and myelination. To investigate functional specialization, researchers could compare lipidomes of tissues with differential TMEM68 expression, particularly focusing on triacylglycerol content, glycerophospholipid composition, and polyunsaturated fatty acid incorporation patterns. Cell type-specific expression within tissues can be further resolved using single-cell RNA sequencing or in situ hybridization techniques, potentially revealing specialized roles in particular neural cell populations or in avian-specific tissues like the bursa of Fabricius.

How does TMEM68 function differ in conditions of lipid stress or metabolic dysfunction, and what experimental models best capture these alterations?

To investigate TMEM68 function under lipid stress or metabolic dysfunction, researchers should design experiments that challenge cellular lipid homeostasis. Several experimental approaches are recommended: First, expose cells expressing recombinant chicken TMEM68 to fatty acid overload conditions (e.g., palmitate, oleate treatment) and assess changes in TMEM68-dependent lipid droplet formation and triacylglycerol synthesis compared to basal conditions . Second, implement glucose deprivation or hypoxic conditions to simulate metabolic stress, monitoring TMEM68 expression, localization, and activity through immunoblotting, immunofluorescence, and lipidomic analyses. Third, use pharmacological inhibitors of lipid metabolism pathways (such as fatty acid synthase inhibitors or lipolysis activators) to disrupt normal lipid flux and observe compensatory roles of TMEM68. For in vivo models, consider metabolic challenge diets (high-fat feeding) in chicken models with TMEM68 perturbation. Recent research shows TMEM68 overexpression affects membrane lipid composition, particularly reducing ether-linked glycerophospholipids and altering polyunsaturated fatty acid distribution in membrane lipids . This suggests TMEM68 may serve as a metabolic switch redirecting fatty acids between storage and membrane lipids under stress conditions. Additionally, examine TMEM68 expression in metabolic disease tissues through collaborations with veterinary pathologists studying avian metabolic disorders. These approaches would provide insights into TMEM68's potential role in adaptive responses to lipid stress or its contribution to metabolic dysfunction.

What are the implications of TMEM68's effect on polyunsaturated glycerophospholipids for membrane dynamics and cellular signaling?

Recent research has revealed that altered TMEM68 expression levels are associated with diminished prevalence of polyunsaturated glycerophospholipids (GPLs) , suggesting profound implications for membrane properties and cellular signaling. Researchers investigating this aspect should consider the following methodological approaches: First, employ biophysical techniques such as fluorescence anisotropy, electron paramagnetic resonance, or laurdan generalized polarization to measure membrane fluidity changes in cells with modulated TMEM68 expression. Second, utilize lipidomics with enhanced detection methods for polyunsaturated fatty acid-containing GPLs to comprehensively profile membrane composition changes across subcellular compartments. Third, assess membrane microdomain organization through detergent-resistant membrane isolation or super-resolution microscopy in TMEM68-modified cells. The functional consequences of these membrane alterations could be investigated by measuring membrane protein lateral mobility using fluorescence recovery after photobleaching (FRAP), examining ion channel function through electrophysiology, or assessing receptor-mediated signaling pathway activation. Additionally, researchers should investigate whether TMEM68's effect on polyunsaturated GPL levels alters cellular responses to oxidative stress, given the susceptibility of polyunsaturated fatty acids to peroxidation. In the context of brain-enriched expression, these changes may have particular significance for neuronal function, synaptic transmission, and neurodegenerative disease processes, suggesting collaborative studies with neuroscience researchers working on lipid-associated neurological conditions.

What are the most promising approaches for generating TMEM68 knockout or transgenic chicken models, and what phenotypes might be anticipated?

For generating TMEM68-modified chicken models, CRISPR/Cas9 genome editing represents the most promising approach, with several methodological considerations. Researchers should design guide RNAs targeting conserved regions of the chicken TMEM68 gene, particularly within catalytic domains essential for acyltransferase activity. Delivery can be accomplished through direct injection into stage X embryos (newly laid eggs) or through primordial germ cell modification followed by germline transmission. To enhance phenotypic analysis, conditional knockout strategies using tissue-specific promoters (particularly brain-specific, given high neural expression) would allow investigation of TMEM68 function while potentially avoiding embryonic lethality if constitutive knockout proves detrimental. Based on TMEM68's established functions, anticipated phenotypes might include altered lipid metabolism profiles with reduced triacylglycerol storage capacity, changes in membrane phospholipid composition (particularly reductions in polyunsaturated species), and potentially neural development abnormalities given the protein's enriched brain expression . Metabolic challenge experiments (high-fat feeding) could reveal more pronounced phenotypes in TMEM68-deficient birds. For transgenic overexpression models, researchers should consider using inducible systems to control TMEM68 expression levels, as constitutive overexpression might disrupt lipid homeostasis. Comprehensive phenotyping should include lipidomic profiling across tissues, metabolic parameter measurements, histological assessment of lipid storage, and detailed neurobehavioral testing to capture potential neural consequences of altered lipid metabolism.

How might TMEM68 function intersect with avian-specific aspects of lipid metabolism, particularly in contexts like egg formation or migration-related fat utilization?

Avian species exhibit unique aspects of lipid metabolism that may intersect with TMEM68 function in biologically significant ways. For egg formation, the massive lipid mobilization required for yolk production represents a species-specific metabolic challenge that could involve TMEM68. Researchers should investigate TMEM68 expression and activity in the liver and reproductive tract of laying hens, particularly during the egg formation cycle, using qPCR, immunohistochemistry, and activity assays. The potential role of TMEM68 in very-low-density lipoprotein (VLDL) formation for yolk deposition could be assessed through selective TMEM68 inhibition in primary chicken hepatocytes followed by VLDL secretion measurement. For migration-related metabolism, seasonal changes in TMEM68 expression in migratory birds could be examined, particularly in flight muscles and adipose tissue before and during migratory periods. The capacity of TMEM68 to influence the fatty acid composition of stored triacylglycerols might be especially relevant for migration, as specific fatty acid profiles provide optimal energy efficiency during sustained flight. Comparative studies between migratory and non-migratory avian species could reveal adaptive changes in TMEM68 sequence or regulation. Additionally, the potential role of TMEM68 in brain-specific lipid metabolism might have implications for migration-related navigation capabilities, as neuronal membrane composition affects signaling properties that could influence magnetoreception or other navigational mechanisms. These avian-specific research directions would provide unique insights into specialized functions of TMEM68 not observable in mammalian models.

Given TMEM68's dual MGAT/DGAT activity, how might targeted modifications to the recombinant protein enhance substrate specificity for biotechnological applications?

TMEM68's dual enzymatic activity as both a monoacylglycerol acyltransferase (MGAT) and diacylglycerol acyltransferase (DGAT) offers opportunities for protein engineering to enhance substrate specificity for biotechnological applications . Researchers should first conduct comprehensive structure-function analyses to identify specific residues responsible for substrate recognition and catalysis. This can be accomplished through systematic alanine scanning mutagenesis of conserved residues, followed by in vitro activity assays with various substrates to map the determinants of specificity. Homology modeling based on related acyltransferases with known structures can guide targeted modifications. For enhancing DGAT specificity, researchers might modify residues in the putative monoacylglycerol binding pocket to reduce MGAT activity while preserving DGAT function. Conversely, for MGAT-specific applications, mutations in the diacylglycerol binding region could decrease DGAT activity. Beyond substrate specificity, engineering efforts could target thermostability for industrial applications by introducing disulfide bridges or optimizing surface charge distribution. Altered fatty acyl-CoA chain length preferences could be achieved by modifying the acyl-CoA binding pocket dimensions. Additionally, researchers might explore creating chimeric proteins that combine TMEM68's catalytic domain with regulatory elements from other acyltransferases to create switchable or stimulus-responsive enzymes. Potential biotechnological applications include enhanced triacylglycerol production for biofuel applications, specialized lipid synthesis for nutraceuticals, or engineered lipid droplet formation for recombinant protein production systems.

What are the implications of recent findings linking TMEM68 to membrane lipid composition for neurodegenerative disease research, and how can chicken TMEM68 contribute to these investigations?

The discovery that TMEM68 influences membrane lipid composition, particularly affecting polyunsaturated glycerophospholipids and ether-linked lipids , has significant implications for neurodegenerative disease research. Researchers can leverage chicken TMEM68 as a model system through several approaches: First, compare chicken and human TMEM68 sequences and functions to identify conserved regulatory mechanisms affecting membrane lipid composition. Chicken neural cells expressing recombinant TMEM68 variants (wild-type or those containing mutations mimicking human polymorphisms) could serve as simplified models for studying lipid metabolism alterations in neurodegenerative conditions. Second, develop chicken primary neuronal cultures with modulated TMEM68 expression to investigate how altered membrane lipid composition affects cellular processes relevant to neurodegeneration, such as amyloid processing, tau phosphorylation, or mitochondrial function. Third, examine TMEM68 interaction with apolipoprotein E metabolism, given APOE's role in lipid transport and Alzheimer's disease risk. The avian system offers unique advantages including cost-effectiveness, rapid development, and accessibility for manipulation compared to mammalian models. Additionally, researchers should investigate whether TMEM68's effects on membrane composition influence neuroinflammatory processes by altering lipid mediator production or microglial activation states. Cross-species comparative studies could reveal whether natural variations in TMEM68 function correlate with species differences in neurodegeneration susceptibility. These investigations could ultimately identify TMEM68 as a novel therapeutic target for modulating membrane lipid composition in neurodegenerative conditions, with chicken models providing valuable preliminary data before translation to mammalian systems.

What are the most significant gaps in our current understanding of chicken TMEM68 function, and what collaborative research approaches might address these limitations?

Despite recent advances in understanding TMEM68 function, significant knowledge gaps remain regarding the chicken-specific variant. The most pressing unknowns include: the tissue-specific expression pattern in chickens, regulatory mechanisms controlling chicken TMEM68 expression, and species-specific substrate preferences or enzymatic kinetics. These gaps limit our understanding of TMEM68's physiological relevance in avian biology. To address these limitations, multidisciplinary collaborative approaches are recommended: Combining transcriptomic profiling across chicken tissues with targeted proteomics could establish comprehensive expression patterns and potential splice variants. Collaborations between structural biologists and enzymologists could illuminate the molecular basis for substrate recognition through crystallography or cryo-EM studies of the protein. Developmental biologists and poultry scientists could investigate TMEM68's role during embryonic development and in economically relevant phenotypes. Computational biologists could apply comparative genomics to identify regulatory elements and evolutionary adaptations specific to the avian lineage. Metabolic physiologists focusing on avian-specific processes like egg production or migration could provide functional contexts for TMEM68 activity. A chicken TMEM68 research consortium integrating these diverse approaches would effectively address current limitations, potentially leading to comprehensive understanding of this protein's role in avian physiology and comparative insights into fundamental lipid metabolism mechanisms .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.