Recombinant Chicken Transmembrane protein 70, mitochondrial (TMEM70)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Chicken Transmembrane Protein 70 (TMEM70)

Recombinant Chicken Transmembrane Protein 70 (TMEM70) is a bioengineered mitochondrial protein expressed in E. coli for research and therapeutic applications. This protein, encoded by the TMEM70 gene, plays a critical role in the biogenesis of ATP synthase (Complex V) within mitochondria . Its recombinant form enables structural and functional studies of mitochondrial energy metabolism and related disorders.

Functional Role in Mitochondrial ATP Synthase Assembly

TMEM70 acts as an ancillary factor for ATP synthase biogenesis:

Key Mechanisms

  1. Subunit c Incorporation

    • TMEM70 binds to subunit c (Su.c) of the ATP synthase rotor, stabilizing its oligomerization and preventing degradation .

    • Knockdown of TMEM70 reduces ATP synthase levels by 40–50%, with residual enzyme lacking Su.c and Su.a subunits .

  2. Cristae Morphology

    • TMEM70 deficiency disrupts cristae formation, leading to irregular mitochondrial ultrastructure .

    • Patient fibroblasts with TMEM70 mutations show reduced Su.c and impaired ATP synthase assembly .

  3. Species-Specific Variations

    • Chicken TMEM70 shares structural homology with human and murine isoforms, enabling cross-species functional studies .

Research Applications and Experimental Insights

Recombinant Chicken TMEM70 is used in:

ApplicationMethodOutcome
Knockdown StudiesDoxycycline-inducible shRNA in HEK293T cells Reduced ATP synthase activity and Su.c accumulation
Patient Fibroblast AnalysisLentiviral transduction of TMEM70-deficient cells Restoration of ATP synthase levels and cristae structure
Protein-Protein InteractionsBlue-Native/SDS-PAGE and immunoprecipitation TMEM70 forms dimers and interacts with unassembled Su.c (300–400 kDa complexes)

Clinical Relevance and Associated Disorders

Mutations in TMEM70 cause mitochondrial complex V deficiency, characterized by:

  • Symptoms: Neonatal encephalopathy, hypertrophic cardiomyopathy, and metabolic crises .

  • Pathogenesis: Impaired ATP synthase assembly reduces oxidative phosphorylation efficiency, leading to energy deficits in high-demand tissues .

Recombinant TMEM70 aids in modeling these diseases and testing therapeutic strategies, such as gene therapy .

Comparative Analysis of Recombinant TMEM70 Products

HostTagPuritySourceApplication
E. coliHis>90%ChickenBiochemical assays
E. coliHis/Fc-Avi>90%HumanELISA, Western blot
Cell-freeN/A≥85%Bovine/MouseStructural studies

Stability and Handling Recommendations

  • Storage: -20°C/-80°C in aliquots to avoid freeze-thaw cycles .

  • Reconstitution: Use sterile water; add glycerol for long-term stability .

  • Avoid: Repeated freezing/thawing, which degrades the protein .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a guideline for your reference.
Shelf Life
Shelf life is influenced by storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is assigned during the production process. If you require a specific tag, please inform us for preferential development.
Synonyms
TMEM70; RCJMB04_5o22; Transmembrane protein 70, mitochondrial
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
80-246
Protein Length
Full Length of Mature Protein
Species
Gallus gallus (Chicken)
Target Names
TMEM70
Target Protein Sequence
HPEHGRLVYKGNLAKAVLGVRFFSYSTSIFNLFMAPYLMLKTGIGFDSLFLQAAFYGLIG FFTFVTPVTLHILTKGYVIRLYYKEEMDTYTAITYNAILAEKATVFHQKDVKIPDITKMF TTFYAKTKSMLVNPTLFPDPQDYNRLMGYDKAFCFDFEEEEKDGESK
Uniprot No.

Target Background

Function
Involved in the biogenesis of mitochondrial ATP synthase.
Database Links
Protein Families
TMEM70 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is the function of TMEM70 in chicken mitochondrial biology?

    TMEM70 is a 21-kDa protein that facilitates the biogenesis of the mitochondrial ATP synthase, the key producer of cellular ATP. In chickens, as in other vertebrates, TMEM70 plays a crucial role in the proper assembly of a functional ATP synthase complex. Research has confirmed that TMEM70 uniquely depends on the formation of the F1 catalytic part of the enzyme during ATP synthase biogenesis . Specifically, TMEM70 helps assemble the membrane rotor ring (c₈-ring) component of ATP synthase, working cooperatively with another transmembrane protein, TMEM242 . Experimental studies using knockout models demonstrate that TMEM70 deficiency leads to an 80% decrease in ATP synthase levels, impaired respiratory control, and compromised mitochondrial ATP production .

  • How can I detect and quantify chicken TMEM70 protein in experimental samples?

    For detection and quantification of chicken TMEM70, several methodological approaches are available:

    a) ELISA-based detection: Specific ELISA kits for chicken TMEM70 provide a sensitive and specific method for quantification. These kits demonstrate minimal cross-reactivity with analogous proteins and offer high reproducibility with standard deviation less than 8% for standards repeated 20 times on the same plate and less than 10% when measured by different operators .

    b) Western blot analysis: Using specific antibodies targeting chicken TMEM70, Western blot can detect the protein at its expected molecular weight of approximately 18 kDa (observed) versus 29 kDa (calculated) . Recommended antibody dilutions for Western blot applications range from 1:1000 to 1:4000.

    c) Immunohistochemistry: IHC can be performed with antibodies at dilutions of 1:50 to 1:500, with optimal results achieved using TE buffer pH 9.0 for antigen retrieval .

  • What expression patterns does TMEM70 show during chicken development?

    TMEM70 demonstrates differential expression patterns between normal and dwarf chickens. Microarray analyses of 14-day-old embryos and 7-week-old chickens showed that TMEM70 is one of only three genes that present with consistent down-regulation in normal chickens but consistent up-regulation in dwarf chickens . Specifically, TMEM70 mRNA expression in dwarf chickens was up-regulated 3.57-fold compared to normal chickens at the embryonic stage, and 5.26-fold higher in 7-week-old dwarf chickens compared to age-matched normal chickens . This suggests TMEM70 expression might be linked to growth regulation pathways in chickens, potentially through interactions with the GH-IGF axis that controls muscle development.

  • What are the characteristics of recombinant chicken TMEM70 proteins?

    Recombinant chicken TMEM70 proteins typically have the following specifications:

    ParameterSpecification
    SourceMammalian cells or other expression systems
    TagsOften His-tagged for purification
    FormLiquid or lyophilized powder
    Endotoxin levels< 1.0 EU per μg protein (LAL method)
    Purity>80%
    Storage-20°C to -80°C for long-term storage
    BufferPBS buffer
    Gene ID420188 (Gallus gallus)
    UniProt IDQ5ZLJ4

    The recombinant protein can be used for antibody production, as a positive control in assays, and for protein-protein interaction studies .

Advanced Research Questions

  • How does the assembly mechanism of ATP synthase involving TMEM70 differ between chickens and mammals?

    The ATP synthase assembly process involving TMEM70 shares fundamental similarities between chickens and mammals, but with species-specific differences. In both systems, TMEM70 participates in the early stages of ATP synthase assembly following the formation of the F1 catalytic part of the enzyme.

    A key distinction in the chicken system is that TMEM70 appears to have evolved specialized interactions with chicken-specific ATP synthase components. Experimental evidence shows that while human TMEM70 mutations typically cause neonatal-onset encephalocardiomyopathy, the phenotypes and severity in animal models vary across species . In chicken TMEM70, the protein selectively interacts with the c-subunit of ATP synthase, forming high molecular mass complexes in the range of 60 to 150 kDa .

    Comparative structural analysis between chicken and human TMEM70 reveals conservation of critical functional domains, but with sequence variations that may affect protein-protein interactions. These species-specific adaptations may reflect evolutionary divergence in mitochondrial function between avian and mammalian lineages .

  • What methodological approaches can resolve contradictory data regarding TMEM70 function in chicken tissues?

    When facing contradictory data regarding TMEM70 function in chicken tissues, researchers should implement the following methodological approaches:

    a) Multiple detection techniques: Employ orthogonal methods such as:

    • Blue-Native electrophoresis to visualize intact ATP synthase complexes

    • Western blot detection with antibodies to ATP synthase (F1-α) and respiratory complexes

    • ATPase in-gel activity assays

    • Oxygen consumption measurements

    b) Tissue-specific analyses: TMEM70 function may vary between tissues. Comprehensive assessment should include:

    • Comparison of cardiac, skeletal muscle, liver, and brain tissue

    • Developmental stage-specific analyses (embryonic vs. post-hatch)

    • Cell-type specific isolation for tissue heterogeneity assessment

    c) Integration of transcriptomic and proteomic data: A key approach exemplified in recent studies involves:

    • Quantitative PCR assays to determine mRNA expression levels in skeletal muscles

    • Microarray analyses to identify differentially expressed genes

    • Correlation analyses between TMEM70 expression and other mitochondrial components

    d) Advanced imaging: Confocal microscopy and electron microscopy have been successfully used to characterize morphological aspects of TMEM70 function, particularly when examining mitochondrial ultrastructure in affected tissues .

  • How can CRISPR-Cas9 gene editing be optimized for studying TMEM70 function in chicken embryos?

    CRISPR-Cas9 gene editing for studying chicken TMEM70 requires specialized optimization:

    a) Guide RNA design: Target specific exonic regions of the chicken TMEM70 gene (Gene ID: 420188) with minimal off-target effects. For chicken applications, design at least 3-4 guide RNAs to account for potential species-specific efficacy variations. Targeting the region encoding the conserved transmembrane domains is particularly effective for functional disruption.

    b) Delivery methods for chicken embryos:

    • Microinjection into stage X embryos (newly laid eggs)

    • In ovo electroporation for later-stage embryos

    • Lentiviral vectors for stable integration and expression

    c) Validation strategies:

    • T7 endonuclease I assay to detect CRISPR-induced mutations

    • Sequencing to confirm precise edits

    • Western blot to verify protein reduction/elimination

    • Blue-Native electrophoresis to assess ATP synthase complex assembly

    d) Phenotypic analysis:

    • ATP synthase activity measurements

    • Oxygen consumption rates in isolated mitochondria

    • Mitochondrial membrane potential assessment using fluorescent dyes

    • Embryonic development monitoring with particular attention to cardiac development

    • Analysis of mitochondrial ultrastructure using electron microscopy

    e) Rescue experiments: Co-expression of wild-type chicken TMEM70 can confirm specificity of the observed phenotypes and rule out off-target effects.

  • What are the interactions between TMEM70 and the GH-IGF axis in chicken muscle development?

    TMEM70 exhibits significant cross-talk with the GH-IGF axis in chicken muscle development, particularly through mitochondrial function regulation. Analysis of differential gene expression in skeletal muscle reveals a complex interplay:

    a) Gene expression correlation: In dwarf chickens with altered GHR (Growth Hormone Receptor) expression, TMEM70 shows inverse regulation compared to normal chickens. Specifically, while GHR expression is down-regulated in normal chickens, TMEM70 is up-regulated 3.57-fold in 14-day-old embryos and 5.26-fold in 7-week-old dwarf chickens .

    b) Signaling pathway integration: TMEM70's influence on ATP synthase assembly affects energy availability for IGF-mediated processes. Recent research demonstrates that IGF2 promotes mitochondrial biogenesis through the PGC1/NRF1/TFAM pathway during myoblast differentiation, enhancing mitochondrial membrane potential, oxidative phosphorylation, and ATP synthesis . This process coordinates with TMEM70 function, as both affect mitochondrial energetics.

    c) Functional consequences: The interaction manifests as altered muscle development patterns:

    • TMEM70 deficiency impairs ATP synthesis, limiting energy for IGF-mediated growth

    • Altered TMEM70 expression affects expression of muscle development genes (MYOD1, MyoG, Myf5)

    • Expression of IGF1 and IGF2BP3 is down-regulated 6.73- and 3.97-fold respectively in dwarf chickens with altered TMEM70 expression

    These interactions suggest a coordinated mitochondrial-nuclear communication system where TMEM70-mediated ATP production supports IGF-dependent muscle development programs.

  • How can heterologous expression systems be optimized for producing functional chicken TMEM70?

    Optimizing heterologous expression of functional chicken TMEM70 requires addressing several technical challenges:

    a) Expression system selection:

    • Mammalian cell systems (HEK293, CHO) provide appropriate post-translational modifications

    • Insect cell systems (Sf9, High Five) offer high yields for membrane proteins

    • Bacterial systems are generally less effective due to the need for proper membrane insertion

    b) Vector design considerations:

    • Include chicken TMEM70 full coding sequence (Gene ID: 420188)

    • Optimize codon usage for the expression system

    • Incorporate purification tags (His, GST) that don't interfere with transmembrane domains

    • Consider inducible promoters to control expression timing

    c) Membrane protein optimization strategies:

    • Lower expression temperatures (28-30°C) to facilitate proper folding

    • Addition of chemical chaperones (glycerol, DMSO at low concentrations)

    • Co-expression with mitochondrial chaperones

    • Detergent screening for optimal extraction (typically mild non-ionic detergents)

    d) Functional validation methods:

    • Complementation assays in TMEM70-deficient cell lines

    • ATP synthase assembly assessment using Blue-Native PAGE

    • Mitochondrial targeting confirmation by subcellular fractionation

    • Circular dichroism to verify secondary structure integrity

    e) Yield and purity optimization:

    • Typical yields from optimized mammalian systems: >80% purity

    • Endotoxin levels should be maintained below 1.0 EU per μg of protein

    • Western blot detection should confirm the expected molecular weight of 18-21 kDa

  • What is the role of TMEM70 in mitochondrial-nuclear communication during chicken embryonic development?

    TMEM70 serves as a key mediator in mitochondrial-nuclear communication during chicken embryonic development through several mechanisms:

    a) Energy sensing and signaling: TMEM70's role in ATP synthase assembly directly impacts cellular energy status, which regulates nuclear gene expression through:

    • AMPK pathway activation during energy deficiency

    • mTOR signaling modulation based on ATP availability

    • Retrograde signaling from mitochondria to nucleus under stress conditions

    b) Developmental trajectory influence: Studies in TMEM70-deficient models demonstrate that impaired ATP synthase assembly leads to:

    • Delayed development of the cardiovascular system

    • Disturbed heart mitochondrial ultrastructure

    • Growth retardation and potential embryonic lethality

    c) Coordination with nuclear-encoded factors: TMEM70 functions within a network that includes:

    • Interaction with TMEM242 for c₈-ring assembly

    • Association with the MCIA complex components (ACAD9, ECSIT, NDUFAF1)

    • Coordination with nuclear-encoded ATP synthase subunits

    d) Metabolic regulation: Analysis of TMEM70's role in dwarf chickens reveals its participation in metabolic programming through:

    • Altered expression correlating with growth hormone receptor signaling

    • Influence on muscle-specific transcription factors (MYOD1, MyoG, Myf5)

    • Potential epigenetic regulation of nuclear gene expression

    These findings indicate that TMEM70 functions as more than just an assembly factor—it serves as a mitochondrial-nuclear communication node that coordinates energy production with developmental gene expression programs during critical phases of chicken embryogenesis.

Technical Research Questions

  • What are the optimal conditions for expressing and purifying recombinant chicken TMEM70?

    Optimal conditions for expression and purification of recombinant chicken TMEM70 include:

    a) Expression system parameters:

    ParameterOptimal ConditionNotes
    Host systemMammalian cells (HEK293T)Provides proper post-translational modifications
    VectorpcDNA3.1 with chicken-optimized TMEM70 sequenceIncludes His-tag for purification
    InductionTetracycline-inducible systemControls expression level
    Culture temperature30°C post-inductionReduces inclusion body formation
    Culture duration48-72 hoursBalances yield and proper folding

    b) Extraction and purification protocol:

    • Subcellular fractionation to isolate mitochondria

    • Gentle solubilization using 1% digitonin or 0.5% DDM

    • Immobilized metal affinity chromatography (IMAC)

    • Size exclusion chromatography for final purification

    • Storage in PBS buffer with glycerol at -80°C

    c) Quality control metrics:

    • Purity >80% as assessed by SDS-PAGE

    • Endotoxin levels <1.0 EU per μg protein

    • Correct molecular weight confirmation (18-21 kDa)

    • Blue Native PAGE to assess oligomeric state

    • Functional validation through ATP synthase assembly assays

  • How can I design effective knockdown experiments for chicken TMEM70 in cell culture models?

    Designing effective TMEM70 knockdown experiments in chicken cell models requires:

    a) RNA interference approach:

    • Design 3-4 siRNA sequences targeting different regions of chicken TMEM70 mRNA

    • Target regions with minimal sequence similarity to other genes

    • Synthesize control siRNAs with scrambled sequences

    • Optimize transfection conditions for chicken cell lines (DF-1, LMH, or primary cells)

    b) Lentiviral shRNA system for stable knockdown:

    • Clone effective siRNA sequences into lentiviral vectors

    • Use chicken U6 promoter for optimal expression

    • Include selection marker (puromycin resistance) for stable cell line generation

    • Verify integration by genomic PCR

    c) Validation and analysis methods:

    • Quantify knockdown efficiency by qRT-PCR (target: 70-90% reduction)

    • Confirm protein reduction by Western blot

    • Assess ATP synthase assembly by Blue Native PAGE

    • Measure functional consequences:

      • Oxygen consumption rate (OCR)

      • ATP production capacity

      • Mitochondrial membrane potential

      • Cell proliferation and viability

    d) Rescue experiments:

    • Express siRNA-resistant TMEM70 (with synonymous mutations)

    • Confirm restoration of ATP synthase assembly

    • Verify recovery of mitochondrial function parameters

    e) Control experiments:

    • Use multiple independent siRNA sequences to confirm specificity

    • Include non-targeting siRNA controls

    • Compare effects to known ATP synthase inhibitors (oligomycin)

  • What approaches can detect structural interactions between chicken TMEM70 and ATP synthase components?

    Several complementary approaches can elucidate the structural interactions between chicken TMEM70 and ATP synthase components:

    a) Co-immunoprecipitation (Co-IP) strategy:

    • Use anti-TMEM70 antibodies to pull down protein complexes

    • Analyze by Western blot for ATP synthase subunits (particularly c-subunit)

    • Perform reciprocal Co-IP with antibodies against ATP synthase components

    • Include appropriate controls (IgG, lysates from TMEM70-knockout cells)

    b) Cross-linking mass spectrometry (XL-MS):

    • Apply membrane-permeable crosslinkers to intact mitochondria

    • Purify TMEM70-containing complexes

    • Perform LC-MS/MS analysis to identify crosslinked peptides

    • Map interaction interfaces between TMEM70 and ATP synthase subunits

    c) Proximity labeling techniques:

    • Generate TMEM70-BioID or TMEM70-APEX2 fusion proteins

    • Express in chicken cell lines or primary cells

    • Identify biotinylated proximal proteins by streptavidin pulldown and MS

    • Quantify enrichment of ATP synthase components

    d) Cryo-electron microscopy:

    • Purify intact ATP synthase complexes with associated assembly factors

    • Perform single-particle cryo-EM analysis

    • Generate 3D reconstructions to visualize TMEM70 binding sites

    • Combine with crosslinking data to validate interaction models

    e) Native gel electrophoresis combined with Western blotting:

    • Blue-Native PAGE to preserve protein complexes

    • Western blot with antibodies against TMEM70 and ATP synthase components

    • Identify co-migrating complexes (particularly in the 60-150 kDa range)

    • Compare wild-type to ATP synthase mutant samples

  • How does TMEM70 expression vary across different chicken tissues and developmental stages?

    TMEM70 expression demonstrates tissue-specific and developmental stage-dependent patterns in chickens:

    a) Tissue-specific expression profile:

    TissueRelative Expression LevelKey Features
    HeartHighCritical for cardiac development and function
    Skeletal muscleModerate to highVaries by muscle type and activity
    LiverModerateImportant for metabolic homeostasis
    BrainModerateRequired for neuronal energy demands
    KidneyLow to moderateSupports energy-intensive transport processes
    Adipose tissueLowLimited role in adipocyte function

    b) Developmental dynamics:

    • Early embryonic stages: Moderate expression with progressive increase

    • Mid-embryonic development (E9-E14): Peak expression coinciding with organogenesis

    • Late embryonic stages: Stabilized high expression in energy-demanding tissues

    • Post-hatch: Tissue-specific modulation based on functional demands

    c) Breed and strain variations:

    • Significant differences between dwarf and normal chickens:

      • 3.57-fold higher expression in 14-day embryos of dwarf chickens

      • 5.26-fold higher expression in 7-week-old dwarf chickens

    • Potential correlation with growth rates and metabolic characteristics in different breeds

    d) Regulatory mechanisms:

    • Coordinated expression with other ATP synthase components

    • Potential involvement of growth hormone signaling pathways

    • Response to metabolic states and energy demands

    • Possible regulation by microRNAs (similar to let-7b regulation seen with GHR)

  • What are the comparative differences in TMEM70 function between chickens and other livestock species?

    Comparative analysis reveals several key differences in TMEM70 function between chickens and other livestock species:

    a) Structural and sequence variations:

    • Chicken TMEM70 (Q5ZLJ4) shows approximately 70-75% sequence identity with mammalian orthologs

    • Conserved transmembrane domains but species-specific variations in matrix-exposed regions

    • Divergent regulatory elements in promoter and untranslated regions

    b) Functional adaptations:

    • Avian-specific interactions with ATP synthase components

    • Potentially adapted to support the high metabolic rate of birds compared to mammals

    • Different temperature optima reflecting avian body temperature (40-42°C vs. 37-39°C in mammals)

    c) Physiological implications:

    • In chickens: Critical for proper cardiac development and muscle function

    • Unique expression pattern in dwarf chickens compared to normal chickens

    • In pigs and cattle: Similar importance for ATP synthase assembly but with species-specific regulatory patterns

    • In fish: Evolutionary divergent function with adaptations to variable temperature environments

    d) Pathological manifestations:

    • Chicken TMEM70 deficiency: Primarily embryonic development defects

    • Mammalian livestock: Neonatal encephalocardiomyopathy similar to human patients

    • Different tissue susceptibility to TMEM70 dysfunction across species

    e) Biotechnological considerations:

    • Species-specific optimization required for recombinant expression

    • Different antibody epitopes necessitating species-specific detection reagents

    • Consideration of species differences when translating research findings

    This comparative understanding is crucial for researchers working across different livestock models and for translating findings between species.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.