Recombinant Chicken Tripartite motif-containing protein 59 (TRIM59)

Shipped with Ice Packs
In Stock

Description

Introduction

Tripartite motif-containing protein 59 (TRIM59) is a protein-coding gene in chickens and other species . Recent research indicates that TRIM59 plays a role in antiviral innate immunity and may serve as a prognostic factor in diseases such as cancer .

General Information

The chicken genome contains the TRIM59 gene, also referred to as Tripartite Motif Containing 59 . TRIM59 contains a transmembrane (TM) domain, a B-box (B) domain, and a RING-finger (R) domain . It functions as a ubiquitin-protein ligase (E3) . The UniProt number for chicken TRIM59 is Q5ZMD4 .

Role in Antiviral Innate Immunity

Research in Cherry Valley ducks suggests TRIM59's involvement in the innate immune response against the novel duck reovirus (NDRV). Overexpression of TRIM59 in duck embryonic fibroblasts (DEF) cells inhibits NDRV replication, particularly when the R domain is intact, which indicates the R domain's importance in controlling NDRV spread . Conversely, reducing TRIM59 levels using small interfering RNA increases NDRV infection in DEF cells . The σNS protein of NDRV can co-localize with TRIM59, promoting NDRV replication .

Involvement in Cancer

TRIM59 is highly expressed in several cancers, where it is associated with tumor progression and poor prognosis . Studies have found that high expression of TRIM59 correlates with increased mortality and recurrence rates in cancer patients, suggesting its potential as a prognostic marker .

TRIM59 as a Diagnostic Marker

TRIM59's elevated expression in tumor tissues compared to adjacent normal tissues suggests its utility as a diagnostic marker in various human cancers . ROC (Receiver Operating Characteristic) analysis has demonstrated its high diagnostic efficacy, especially in Cholangiocarcinoma (CHOL), with prediction accuracy reaching 100% . A meta-analysis combining GEO datasets revealed that high TRIM59 expression is associated with poor prognosis in several cancers, including Kidney renal papillary cell carcinoma (KIRP), Lower grade glioma (LGG), and Lung adenocarcinoma (LUAD) .

Functional Studies

In vitro and animal studies indicate that decreasing TRIM59 expression significantly inhibits tumor growth . TRIM59 promotes cancer cell migration and invasion, while its knockdown inhibits malignancy in human cancer cells . TRIM59 can activate the TGF-β signaling pathway, promoting proliferation, migration, and invasion of breast cancer cells by decreasing the protein expression level of p-smad2 .

Clinical Significance

High TRIM59 expression has been observed in various cancers, including colorectal, breast, hepatocellular carcinoma, lung, and gastric cancers .

Meta-Analysis Findings

A meta-analysis investigating TRIM59's prognostic role in tumor patients revealed that high TRIM59 expression is associated with poor prognoses in cancer patients . TRIM59 was related to TNM (Tumor Node Metastasis) in hepatocellular carcinoma, lung cancer, colorectal cancer, and breast cancer .

Table 1: Diagnostic Efficacy of TRIM59 in Cancers Using ROC Analysis

Cancer TypePrediction Accuracy
CHOL100%

Table 2: Prognostic Impact of TRIM59 Expression in Various Cancers

Cancer TypePrognosis
KIRPPoor
LGGPoor
LUADPoor
Lung CancerPoor
CESCBetter
SKCMBetter

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline for customers.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
TRIM59; RCJMB04_2h17; Tripartite motif-containing protein 59
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-408
Protein Length
full length protein
Species
Gallus gallus (Chicken)
Target Names
Target Protein Sequence
MHQFEEELTCSICYSLFEDPRVLPCSHTFCRSCLEGVIQLSSNFSIWRPLRVPLKCPNCR SIVEIPASGTESLPINFALKAIIEKYRQEDHSDVATCSEHYRQPLNVYCLLDKKLVCGHC LTIGKHNGHPIDDLHSAYLKEKESSGKILEQLTDKHWSDVCLLIEKLKEQKAQCESIVQD DKKVVVQYFKKLSETLEHKKQVLLAALDEINRQILEEYEPHIEKLKKIREEQLELMSLNT SIQKEESPLVFLEKVDNVHQRIKALKEKELPDVKPVEVYPRVGHLLKDVWSKTEIGQINK ILTPKIKLVPKRKLHSKNSEKERGKPEELLQAANPLSVTFIFTVIIAIAVLSFHKPISSV VIESIPTHISDFFGFLYQDFCTCMQNTVDVVCHKLNSLAEFLGGIVPF
Uniprot No.

Target Background

Function

Recombinant Chicken Tripartite motif-containing protein 59 (TRIM59) may function as a multifunctional regulator in innate immune signaling pathways.

Database Links
Protein Families
TRIM/RBCC family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein.

Q&A

What is the basic structure of Chicken TRIM59 protein?

Chicken Tripartite motif-containing protein 59 (TRIM59) is a member of the TRIM/RBCC protein family characterized by its N-terminal domains containing a tripartite motif. The full-length protein consists of 408 amino acid residues (Q5ZMD4) and contains the characteristic RBCC motif comprising a RING domain, B-Box motifs, and a coiled-coil region. The RING domain confers E3-ligase activity, enabling protein ubiquitination functions. In recombinant form, it is often expressed with tags such as His-tag to facilitate purification and detection .

What are the primary functions of TRIM59 in normal cellular processes?

TRIM59 functions primarily in immune regulation, particularly in phagocytosis and innate immune responses. Studies have demonstrated that TRIM59 serves as an essential accessory molecule in mediating macrophage tumoricidal functions. Immunohistochemistry analysis reveals that in chickens, TRIM59 is abundantly expressed in spleen, stomach, and ovary tissues, with intermediate expression in brain, lung, kidney, muscle, and intestine tissues. The protein participates in cell-molecule interactions and enhances the pinocytosis and phagocytosis activity of macrophages . It also plays a role in protein ubiquitination pathways due to its E3 ubiquitin ligase activity through the RING finger domain .

How is TRIM59 expression regulated in normal versus pathological states?

In normal states, TRIM59 shows tissue-specific expression patterns, with higher levels in epithelial tissues of specific organs. During pathological conditions, particularly in inflammatory responses, TRIM59 expression is dynamically regulated. For instance, in lipopolysaccharide (LPS)-stimulated bone marrow-derived macrophages (BMDMs), TRIM59 is significantly downregulated . In contrast, in numerous cancer types, TRIM59 is upregulated compared to adjacent normal tissues. This differential regulation indicates context-dependent transcriptional control mechanisms that respond to various cellular stresses, inflammatory signals, and oncogenic pathways .

What are the optimal methods for expressing and purifying recombinant Chicken TRIM59?

For effective expression and purification of recombinant Chicken TRIM59:

  • Expression System Selection: E. coli is the most commonly used expression system for full-length Chicken TRIM59 protein (1-408aa) with an N-terminal His-tag .

  • Vector Design: Ensure the vector contains appropriate promoters (such as T7) and the sequence is codon-optimized for E. coli expression.

  • Purification Protocol:

    • Lyse cells in Tris/PBS-based buffer (pH 8.0)

    • Perform affinity chromatography using Ni-NTA columns for His-tagged proteins

    • Elute with imidazole-containing buffer

    • Conduct size exclusion chromatography for higher purity

    • Store in Tris/PBS buffer with 6% Trehalose at pH 8.0

  • Quality Control: Verify purity through SDS-PAGE (>90% purity) and confirm protein identity via Western blotting using anti-TRIM59 antibodies.

  • Storage Recommendations: Store lyophilized powder at -20°C/-80°C. After reconstitution, add 5-50% glycerol (final concentration) and store working aliquots at 4°C for up to one week. Avoid repeated freeze-thaw cycles .

What are reliable methods for detecting TRIM59 expression in chicken tissues?

Multiple methods can be employed for detecting TRIM59 expression in chicken tissues:

  • Immunohistochemistry (IHC):

    • Fix tissues in formalin and embed in paraffin

    • Section tissues at 4-μm thickness

    • Perform antigen retrieval

    • Incubate with anti-TRIM59 antibody (typical dilution 1:2000)

    • Use appropriate secondary antibodies (e.g., goat anti-rabbit)

    • Develop with 3,3-diaminobenzidine

    • Counterstain with hematoxylin

  • Western Blotting:

    • Extract proteins using RIPA buffer

    • Measure protein concentration using bicinchoninic acid assay

    • Separate proteins on 10% SDS-PAGE gel

    • Transfer to PVDF membranes

    • Block and incubate with anti-TRIM59 antibody (1:5000)

    • Use GAPDH as internal reference

    • Analyze band intensity using ImageJ software

  • Reverse Transcription-PCR (RT-PCR):

    • Extract total RNA using TRIzol Reagent

    • Measure RNA purity by spectroscopy

    • Perform RT-PCR with TRIM59-specific primers

    • Calculate relative expression using the 2^-ΔΔCt method with GAPDH as internal reference

How can researchers effectively silence or knockout TRIM59 in experimental models?

Researchers can employ several strategies to silence or knockout TRIM59:

  • siRNA Technology:

    • Design siRNA targeting specific sequences (e.g., CCCTGAACATTACAGGCAA has been validated)

    • Transfect cells using Lipofectamine™ 2000 reagent

    • Include scrambled siRNA as control

    • Allow 48 hours post-transfection before analyzing the effects

    • Verify silencing efficiency by Western blot and RT-PCR

  • CRISPR/Cas9 System:

    • Design guide RNAs targeting exons of the TRIM59 gene

    • Create conditional knockout models (e.g., Trim59^flox/flox Lyz-Cre) for tissue-specific deletion

    • Validate knockout efficiency at both genomic and protein levels

    • Use appropriate controls (Trim59^flox/flox without Cre)

  • Lentiviral shRNA:

    • Design shRNA constructs targeting TRIM59

    • Generate stable cell lines with constitutive TRIM59 knockdown

    • Select positive clones using appropriate antibiotics

    • Validate knockdown efficiency through Western blotting and RT-PCR

How does TRIM59 expression correlate with cancer progression and prognosis?

TRIM59 expression demonstrates significant correlations with cancer progression and patient outcomes:

These findings suggest TRIM59 could serve as both a prognostic biomarker and potential therapeutic target in various cancers.

Which signaling pathways are modulated by TRIM59 in cancer progression?

TRIM59 modulates several key signaling pathways in cancer progression:

  • FAK/AKT/MMP Pathway:

    • TRIM59 promotes phosphorylation of FAK and AKT

    • Silencing TRIM59 reduces phospho-FAK, phospho-AKT, MMP2, and MMP9 levels

    • This pathway mediates cell proliferation, migration, and invasion in epithelial ovarian cancer

  • NF-κB Pathway:

    • TRIM59 influences the NF-κB pathway by regulating IKKα/β phosphorylation

    • It affects IκBα degradation and p65 nuclear translocation

    • In NSCLC, TRIM59 promotes tumor aggressiveness through NF-κB activation

  • JAK/STAT Signaling:

    • TRIM59 interacts with STAT1 by recruiting PIAS1 to suppress STAT1 activation

    • It suppresses IL-1β-induced activation of the JAK2/STAT3 pathway

    • This regulation impacts immune responses and inflammation in tumor microenvironments

  • TRAF2 Regulation:

    • TRIM37 (another TRIM family member) promotes K63 polyubiquitination of TRAF2, activating NF-κB signaling

    • Similar mechanisms might apply to TRIM59, given the structural similarity within the TRIM family

Understanding these pathway interactions provides potential targets for therapeutic interventions in TRIM59-overexpressing cancers.

What methodologies are most effective for studying TRIM59's role in tumor development models?

For investigating TRIM59's role in tumor development, researchers should consider these methodological approaches:

  • In Vitro Functional Assays:

    • Cell proliferation: CCK-8 assay to measure cell viability over time

    • Migration: Wound healing assay to assess closure of scratched cell monolayers

    • Invasion: Transwell assay with Matrigel coating to evaluate invasive capacity

    • Colony formation: Assessment of cells' ability to form colonies after silencing or overexpressing TRIM59

  • In Vivo Tumor Models:

    • Subcutaneous xenograft models using TRIM59-silenced or overexpressing cells

    • Orthotopic implantation for organ-specific tumor growth assessment

    • Conditional knockout mouse models (e.g., TRIM59^flox/flox tissue-specific Cre) to evaluate endogenous TRIM59 functions

  • Molecular Mechanism Investigation:

    • Co-immunoprecipitation to identify TRIM59 binding partners

    • Ubiquitination assays to evaluate E3 ligase activity

    • Chromatin immunoprecipitation (ChIP) to assess transcriptional regulation

    • Proteomics analysis to identify downstream effectors using LC-MS/MS

  • Clinical Correlation Analysis:

    • Tissue microarray (TMA) construction for high-throughput immunohistochemical analysis

    • Scoring systems based on staining intensity and percentage of positive cells

    • Correlation with clinicopathological parameters and survival data

    • Bioinformatic analysis of public databases (TCGA, GEO) for validation

How does TRIM59 function in innate immune responses?

TRIM59 plays multifaceted roles in innate immune responses:

  • Regulation of Inflammatory Signaling:

    • TRIM59 modulates the NF-κB pathway, a critical mediator of inflammatory responses

    • In sepsis models, TRIM59 protects mice by regulating inflammation

    • TRIM59 conditional knockout (Trim59-cKO) mice show increased mortality, more severe immune cell infiltration, and tissue damage in cecal ligation and puncture (CLP) sepsis models

  • Phagocytosis Regulation:

    • TRIM59 enhances the phagocytic and pinocytotic activity of macrophages

    • It serves as an essential accessory molecule in BCG-activated macrophages (BAM)

    • Blocking TRIM59 with antibodies significantly reduces BAM cytotoxicity against cancer cells

  • Cytokine Production:

    • TRIM59 alters the production of pro-inflammatory cytokines

    • Loss of TRIM59 affects expression levels of inflammatory mediators

    • It regulates the balance between protective immunity and excessive inflammation

  • Pathogen Clearance:

    • TRIM59 influences bacterial burden in infection models

    • In sepsis, Trim59-cKO mice show increased bacterial load

    • This suggests a role in pathogen recognition and clearance mechanisms

What experimental models are best suited for studying TRIM59's role in immune function?

Several experimental models are particularly effective for investigating TRIM59's immune functions:

  • Macrophage Activation Systems:

    • Bone Marrow-Derived Macrophages (BMDMs) isolation and culture

    • BCG-activated macrophages (BAM) model

    • LPS stimulation of macrophages (0.2 μg/ml) with time-course analysis

    • Raw264.7 cell line with TRIM59 overexpression or knockdown

  • In Vivo Infection Models:

    • Cecal Ligation and Puncture (CLP) mouse model of sepsis

    • Conditional knockout systems (Trim59^flox/flox Lyz-Cre) for myeloid-specific deletion

    • Bacterial burden assessment in tissues and blood

    • Survival analysis and tissue damage evaluation

  • Functional Assays:

    • Phagocytosis assays using fluorescently labeled particles or bacteria

    • Cytotoxicity assays against target cells (e.g., MCA207 cells)

    • Pinocytosis measurement using dextran uptake

    • Inflammatory cytokine production assessment via ELISA or multiplex assays

  • Signaling Pathway Analysis:

    • Western blot analysis of NF-κB pathway components (IKKα/β, IκBα, p65)

    • Nuclear translocation assessment of transcription factors

    • Phosphorylation status of key signaling molecules

    • Time-course experiments to capture signaling dynamics

How can researchers distinguish between TRIM59's direct and indirect effects on immune cell function?

To distinguish between direct and indirect effects of TRIM59 on immune cell function:

  • Mechanistic Dissection Approaches:

    • Use structure-function analysis with domain-specific mutants (particularly the RING domain)

    • Employ reconstitution experiments in knockout cells with wild-type or mutant TRIM59

    • Perform temporal analysis of signaling events after stimulation

    • Apply specific pathway inhibitors to identify dependency relationships

  • Protein-Protein Interaction Analysis:

    • Conduct co-immunoprecipitation to identify direct binding partners

    • Use proximity ligation assays to verify interactions in intact cells

    • Apply mass spectrometry for unbiased identification of TRIM59 complexes

    • Perform in vitro binding assays with purified recombinant proteins

  • Ubiquitination Target Identification:

    • Assess ubiquitination status of potential targets in presence or absence of TRIM59

    • Determine ubiquitin chain types (K48 vs. K63) to predict functional outcomes

    • Use proteasome inhibitors to distinguish between degradative and non-degradative ubiquitination

    • Apply TRIM59 RING domain mutants as negative controls

  • Transcriptional Profiling:

    • Compare gene expression changes in wild-type versus TRIM59-deficient cells

    • Perform time-course analysis after immune stimulation

    • Use pathway enrichment analysis to identify directly affected processes

    • Validate key findings with chromatin immunoprecipitation studies

How do post-translational modifications affect TRIM59 function and stability?

Post-translational modifications likely play crucial roles in regulating TRIM59 function:

  • Self-Ubiquitination:

    • As an E3 ubiquitin ligase with a RING domain, TRIM59 may undergo auto-ubiquitination

    • This process could regulate its own stability and turnover

    • Different ubiquitin chain types (K48 vs. K63) would determine degradative versus signaling outcomes

    • Research methods should include in vitro ubiquitination assays with purified components and mass spectrometry analysis of modification sites

  • Phosphorylation:

    • Kinase-mediated phosphorylation may alter TRIM59's activity, localization, or interactions

    • Inflammatory signaling likely induces phosphorylation events on TRIM59

    • Phosphoproteomic analysis of TRIM59 under different stimulation conditions could reveal regulatory sites

    • Site-directed mutagenesis of potential phosphorylation sites would help determine functional significance

  • Other Modifications:

    • SUMOylation, methylation, or acetylation might add additional regulatory layers

    • These modifications could create or disrupt interaction surfaces for binding partners

    • Crosstalk between different modifications might create complex regulatory networks

    • Mass spectrometry-based approaches would be valuable for comprehensive modification mapping

Investigating these modifications would provide insights into how TRIM59 activity is fine-tuned in different cellular contexts.

What are the species-specific differences in TRIM59 function between chicken and mammalian models?

Understanding species-specific differences in TRIM59 function requires comparative analysis:

  • Structural Comparison:

    • Chicken TRIM59 consists of 408 amino acids compared to human TRIM59's 403 amino acids

    • Sequence alignment reveals conserved domains but potentially variable regions

    • Functional domains (RING, B-Box, coiled-coil) show different degrees of conservation

    • Structural biology approaches (X-ray crystallography or cryo-EM) would provide insight into 3D structural differences

  • Expression Pattern Differences:

    • In chickens, TRIM59 is abundantly expressed in spleen, stomach, and ovary

    • Expression is intermediate in brain, lung, kidney, muscle, and intestine

    • This differs from human expression patterns, which show variable expression across tissues

    • Comparative transcriptomic and proteomic analyses across species would help map these differences

  • Functional Divergence:

    • Substrate specificity of E3 ligase activity may differ between species

    • Signaling pathway integration points might vary

    • Immune function roles could be adapted to species-specific immune challenges

    • Cross-species complementation studies and substrate identification would elucidate these differences

  • Experimental Design Considerations:

    • When using chicken TRIM59 as a model, researchers must be cautious about extrapolating to human systems

    • Species-specific binding partners should be identified and compared

    • Cross-reactivity of antibodies and tools must be validated

    • Parallel experiments in both systems would strengthen translational relevance

What is the potential of TRIM59-targeting approaches for therapeutic development?

TRIM59's involvement in cancer progression and immune regulation presents therapeutic opportunities:

  • Cancer Therapy Applications:

    • TRIM59 silencing significantly suppresses cancer cell proliferation, migration, and invasion in multiple cancer types

    • Targeting TRIM59 could sensitize resistant tumors to conventional therapies

    • High expression in multiple tumor types provides a broad therapeutic window

    • Development strategies could include small molecule inhibitors of E3 ligase activity, degraders (PROTACs), or gene therapy approaches

  • Immune Modulation Approaches:

    • TRIM59's role in regulating inflammation suggests applications in inflammatory diseases

    • Enhancing TRIM59 function might protect against sepsis based on mouse models

    • Modulating TRIM59 could influence macrophage phagocytic function in infectious diseases

    • Targeted delivery to specific immune populations would be critical for therapeutic applications

  • Biomarker Development:

    Cancer TypeTRIM59 Diagnostic Value (AUC)Prognostic Association
    Ovarian0.92 (0.88-0.96)Poor OS and PFS
    Lung0.91 (0.87-0.95)Poor OS
    Kidney0.93 (0.89-0.97)Poor OS in KIRP
    Breast0.95 (0.91-0.99)Poor OS
    Liver0.98 (0.96-1.00)Variable
    • This data supports TRIM59 as a multi-cancer biomarker for early detection and prognosis

  • Drug Discovery Challenges:

    • E3 ligases are challenging targets for small molecule development

    • Substrate specificity must be maintained to avoid off-target effects

    • Tissue-specific delivery systems would be required for targeted therapy

    • Combination approaches with existing therapies might provide synergistic effects

Developing TRIM59-targeted therapeutics would require thorough validation in preclinical models before clinical translation.

How can researchers address inconsistent results in TRIM59 expression studies?

When facing inconsistent TRIM59 expression results:

  • Antibody Validation:

    • Verify antibody specificity using positive controls (tissues known to express TRIM59)

    • Include negative controls (tissues with minimal TRIM59 expression like thymus, liver, heart)

    • Test multiple antibodies targeting different epitopes of TRIM59

    • Validate results with orthogonal methods (protein vs. mRNA detection)

  • Technical Considerations:

    • Standardize sample collection, processing, and storage conditions

    • Optimize antigen retrieval methods for immunohistochemistry

    • Use consistent protein extraction buffers and protocols

    • Normalize data with appropriate housekeeping genes or proteins

  • Biological Variability Management:

    • Account for tissue heterogeneity by microdissection or single-cell approaches

    • Consider dynamic regulation of TRIM59 under different conditions

    • Document and control for variables like inflammation status or treatment history

    • Increase biological replicates to establish reliable patterns

  • Data Analysis Approaches:

    • Apply consistent scoring methods for immunohistochemistry

    • Use quantitative image analysis software for objective assessment

    • Implement appropriate statistical tests based on data distribution

    • Consider meta-analysis approaches when comparing across studies

What are strategies for improving recombinant TRIM59 protein solubility and stability?

To enhance recombinant TRIM59 protein solubility and stability:

  • Expression Optimization:

    • Test different expression temperatures (16-30°C) to improve folding

    • Use specialized E. coli strains designed for difficult proteins (e.g., Rosetta for rare codons)

    • Consider solubility-enhancing fusion partners (SUMO, MBP, TRX) beyond His-tag

    • Optimize induction conditions (IPTG concentration, induction time)

  • Buffer Formulation:

    • Current recommended buffer contains Tris/PBS with 6% Trehalose at pH 8.0

    • Test buffer optimization with various additives:

      • Non-ionic detergents (0.01-0.1% Triton X-100 or NP-40)

      • Glycerol (5-20%) to prevent aggregation

      • Salt concentration variations (150-500 mM NaCl)

      • Reducing agents (DTT or TCEP) to maintain disulfide bonds

  • Protein Engineering Approaches:

    • Express functional domains separately if full-length protein is problematic

    • Remove hydrophobic regions predicted to cause aggregation

    • Introduce solubility-enhancing mutations based on structural predictions

    • Consider mammalian or insect cell expression for complex proteins

  • Storage and Handling:

    • Lyophilize protein with stabilizing agents (trehalose, sucrose)

    • Store at -80°C for long-term stability

    • Avoid repeated freeze-thaw cycles by preparing single-use aliquots

    • Add 5-50% glycerol for frozen storage of solutions

How can researchers accurately interpret conflicting data on TRIM59's role across different experimental systems?

When interpreting conflicting data on TRIM59's role:

  • Context-Dependent Function Analysis:

    • TRIM59 functions differently in various cellular contexts and disease states

    • Carefully document experimental conditions, cell types, and disease models

    • Consider that TRIM59 may have opposite effects in different tissues or under different stimuli

    • Create a comprehensive map of context-dependent functions based on literature

  • Methodological Reconciliation:

    • Compare knockout versus knockdown approaches (complete absence vs. reduced expression)

    • Distinguish between acute versus chronic modulation of TRIM59

    • Consider off-target effects of siRNA or CRISPR approaches

    • Evaluate the specificity of overexpression systems and potential artifacts

  • Experimental Design Considerations:

    • Include appropriate positive and negative controls

    • Use multiple independent methods to validate key findings

    • Perform dose-response and time-course experiments

    • Test hypotheses in multiple cell lines or model systems

  • Integration of Multi-Omics Data:

    • Combine transcriptomic, proteomic, and functional data

    • Use systems biology approaches to model TRIM59's role in complex networks

    • Apply machine learning techniques to identify patterns across datasets

    • Develop predictive models that account for context-dependent functions

By carefully considering these factors, researchers can build a more comprehensive understanding of TRIM59's complex roles across different experimental systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.