Recombinant Chicken Type-1 angiotensin II receptor (AGTR1)

Shipped with Ice Packs
In Stock

Description

Definition and Production

Recombinant Chicken AGTR1 refers to the genetically engineered version of the Type-1 angiotensin II receptor expressed in heterologous systems such as E. coli or mammalian cells. Unlike native AGTR1, which is embedded in cell membranes, the recombinant form is often purified for in vitro studies. Production typically involves:

  • Expression Systems: Baculovirus-insect cell or E. coli systems for high-yield protein synthesis .

  • Tagging: Biotinylation via AviTag-BirA technology for improved detection in assays .

Research Applications

Recombinant Chicken AGTR1 is primarily utilized in:

  • ELISA Development: Serves as a standard in kits for quantifying AGTR1 levels in chicken serum, plasma, and tissue homogenates .

  • Mechanistic Studies: Investigating angiotensin II-mediated vasoconstriction, aldosterone regulation, and hypertension pathways .

  • Comparative Biology: Analyzing evolutionary conservation of RAS components across species .

Challenges and Future Directions

Current limitations include the need for species-specific validation of cross-reactivity in immunoassays. Future research may explore:

  • Structural Resolution: Cryo-EM studies to map ligand-binding domains.

  • Therapeutic Targeting: Evaluating AGTR1 antagonists in avian metabolic disorders.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. For precise delivery estimates, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference for your own preparations.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize development of the specified tag.
Synonyms
AGTR1; Type-1 angiotensin II receptor; Angiotensin II type-1 receptor; AT1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-359
Protein Length
Full length protein
Species
Gallus gallus (Chicken)
Target Names
Target Protein Sequence
MVPNYSTEETVKRIHVDCPVSGRHSYIYIMVPTVYSIIFIIGIFGNSLVVIVIYCYMKLK TVASIFLLNLALADLCFLITLPLWAAYTAMEYQWPFGNCLCKLASAGISFNLYASVFLLT CLSIDRYLAIVHPVKSRIRRTMFVARVTCIVIWLLAGVASLPVIIHRNIFFAENLNMTVC GFRYDNNNTTLRVGLGLSKNLLGFLIPFLIILTSYTLIWKTLKKAYQIQRNKTRNDDIFK MIVAIVFFFFFSWIPHQVFTFLDVLIQLHVITDCKITDIVDTAMPFTICIAYFNNCLNPF FYVFFGKNFKKYFLQLIKYIPPNVSTHPSLTTKMSSLSYRPPENIRLPTKKTAGSFDAE
Uniprot No.

Target Background

Function
Angiotensin II receptor type 1 (AGTR1) serves as the receptor for angiotensin II. It mediates angiotensin II's actions by associating with G proteins, which activate a phosphatidylinositol-calcium second messenger system.
Gene References Into Functions
  1. In contrast to previous genome-wide association studies and microsatellite data, our findings indicate no association between SNP genotypes or haplotypes in the region between 11.8 and 13.6 Mbp on chromosome 9. This suggests that the AGTR1 and UTS2D genes may have limited association with the disease phenotype. PMID: 28339549
  2. Investigations of gene expression and the role of the Ang II receptor during embryonic development have revealed expression in the chorioallantoic membrane (CAM) and heart of the embryo. However, the effect of an Ang II receptor antagonist on embryonic blood pressure appears to be limited. PMID: 20495810
Database Links

KEGG: gga:396065

STRING: 9031.ENSGALP00000039674

UniGene: Gga.632

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure of chicken AGTR1 and how does it compare to mammalian homologs?

Chicken AGTR1 is a classic seven-transmembrane domain G-protein coupled receptor (GPCR) with a molecular weight of 41,220 Da, encoded by the AGTR1 gene (UniProt code: P79785) . Unlike in murine species where the AT1 receptor is subdivided into AT1A and AT1B subtypes, the chicken AGTR1, similar to humans, does not exhibit this subdivision . The receptor is classified as a multi-pass membrane protein located in the cell membrane and functions as the primary receptor for angiotensin II in the renin-angiotensin system . Structurally, the chicken AGTR1 shares significant homology with mammalian counterparts, although species-specific variations in binding domains and regulatory elements have been documented through comparative genomics analyses.

How does AGTR1 signaling work in avian systems compared to mammals?

In chicken systems, AGTR1 activates the classical Gq/11 protein and phospholipase C pathway, similar to mammals, producing second messengers such as inositol trisphosphate and diacylglycerol . These second messengers trigger intracellular calcium flux and activate various protein kinases, including the extracellular regulated kinases ERK1/2 . The signaling cascade ultimately influences vascular tone, cell growth, and fluid-electrolyte balance. While the fundamental signaling mechanisms appear conserved across species, avian-specific modulations exist in downstream effectors and regulatory feedback systems. Recent research suggests that in chickens, AGTR1 signaling may be particularly important in pulmonary vasculature, as variants of the AGTR1 gene have been associated with ascites (pulmonary arterial hypertension) in broiler chickens .

What are the most reliable methods for detecting AGTR1 expression in chicken tissues?

Multiple complementary approaches are recommended for reliable detection of AGTR1 expression in chicken tissues. Enzyme-linked immunosorbent assay (ELISA) represents a highly sensitive method for quantifying AGTR1 protein levels in serum, plasma, tissue homogenates, and cell culture supernatants . For tissue-specific localization, immunohistochemistry using validated antibodies against chicken AGTR1 provides spatial resolution of receptor distribution. At the transcript level, quantitative PCR (qPCR) remains the gold standard for measuring AGTR1 mRNA expression, while RNA sequencing offers a more comprehensive view of expression patterns in relation to other genes. For research requiring higher sensitivity, radioligand binding assays using [125I]-labeled angiotensin II can assess receptor density and binding affinity in membrane preparations from various chicken tissues.

How can researchers optimize ELISA protocols for chicken AGTR1 quantification?

Optimizing ELISA protocols for chicken AGTR1 quantification requires attention to several critical parameters. First, proper sample preparation is essential—for serum and plasma, collection with appropriate anticoagulants followed by prompt centrifugation minimizes interference from cellular components . For tissue homogenates, standardized extraction buffers containing protease inhibitors help preserve AGTR1 integrity. Second, researchers should establish appropriate dilution series for each sample type to ensure measurements fall within the linear range of the standard curve. The chicken AGTR1 ELISA kit typically provides intra-assay and inter-assay coefficient variations (CV), linearity measurements, and recovery rates that should be verified during protocol optimization . Temperature control during incubation steps and precise timing of substrate addition and stop solution application are critical for reproducible results. Finally, cross-validation with other detection methods such as Western blotting is recommended to confirm specificity, particularly when working with novel tissue types or experimental conditions.

What genomic evidence exists for selection at the AGTR1 locus during chicken domestication?

Genomic analyses comparing wild red jungle fowl to domestic chicken populations have revealed compelling evidence for selection at the AGTR1 locus. Population sequencing studies have identified significant allele frequency differences in AGTR1 between wild and commercial chicken lines, with particularly high fixation indices observed in commercial layers (AF WL = 0.98, AF BL = 0.98) and slightly lower but still elevated frequencies in broilers (AF BR = 0.86) . This pattern suggests strong positive selection during domestication and subsequent breed development. The timing of this selection is hypothesized to be relatively recent, occurring after chickens were maintained in captive systems and subjected to intensive feeding regimes . The selection pattern at AGTR1 differs from other well-documented domestication loci such as BCO2 and TSHR, potentially representing adaptation to specific production environments rather than early domestication events. These findings align with broader genomics research showing that commercial chicken lines have higher frequencies of population-specific alleles compared to wild populations, reflecting generations of selective breeding to enhance favorable traits .

How do AGTR1 polymorphisms correlate with production traits and disease susceptibility in commercial chicken lines?

AGTR1 polymorphisms show significant correlations with both production traits and disease susceptibility in commercial chicken lines. Most prominently, AGTR1 variants have been associated with ascites (pulmonary arterial hypertension), a condition that causes significant mortality in broiler chickens subjected to fast growth rates and heavy diets . The molecular mechanism likely involves altered regulation of pulmonary vasculature tone and remodeling in response to hypoxic conditions during rapid growth. Beyond respiratory physiology, emerging research suggests potential associations between AGTR1 variants and cardiovascular performance metrics that influence feed efficiency and stress resilience. Genome-wide association studies have identified AGTR1 locus variations that correlate with blood pressure regulation, which may indirectly affect growth rate and meat quality traits in broilers. In layer lines, where AGTR1 appears to be more completely fixed (AF ≈ 0.98), the relationship between genotype and production traits is less clear, suggesting potential pleiotropic effects or linkage with other selected loci . These findings highlight the complex interplay between AGTR1 genetic architecture and phenotypic outcomes in different commercial lineages.

How can recombinant AGTR1 be utilized in studying pulmonary arterial hypertension (ascites) in broiler chickens?

Recombinant chicken AGTR1 provides a valuable tool for studying pulmonary arterial hypertension (PAH), known as ascites in the poultry industry. Researchers can employ recombinant AGTR1 in binding assays to screen for novel compounds that selectively modulate receptor activity, potentially identifying therapeutic candidates for ascites prevention. Cell-based systems expressing recombinant AGTR1 allow for detailed characterization of signaling cascades under normoxic versus hypoxic conditions, illuminating the molecular mechanisms by which AGTR1 variants contribute to PAH pathogenesis . For more complex models, primary pulmonary artery smooth muscle cells can be transfected with wild-type or variant AGTR1 constructs to assess differences in proliferation, migration, and contractility in response to angiotensin II. Additionally, developing chicken embryo chorioallantoic membrane (CAM) assays incorporating recombinant AGTR1 variants offers an efficient system for evaluating vascular remodeling processes relevant to ascites development. These experimental approaches collectively enable a comprehensive understanding of how AGTR1 polymorphisms influence susceptibility to PAH in rapidly growing broiler chickens.

What evidence exists for AGTR1 involvement in vascular dysfunction models beyond pulmonary hypertension?

Beyond pulmonary hypertension, substantial evidence indicates AGTR1 involvement in multiple models of vascular dysfunction. Studies in rat models of rheumatoid arthritis have demonstrated that endothelium-derived contraction is mediated via AGTR1, suggesting a mechanistic role in inflammatory vascular impairment . In oncology research, AGTR1 antagonists like telmisartan have shown efficacy in reducing tumor growth in mouse models of endometrial cancer, implicating AGTR1 signaling in tumor angiogenesis and progression . Within avian systems specifically, emerging data suggest AGTR1 may contribute to stress-induced vascular responses and adaptations to varying environmental conditions. The evolutionary conservation of AGTR1's role in vascular homeostasis across species provides a strong rationale for comparative studies using recombinant chicken AGTR1 to identify both conserved and divergent aspects of receptor function in different pathological contexts. These broader applications of AGTR1 research highlight its potential significance beyond respiratory disorders, extending to cardiovascular, inflammatory, and neoplastic conditions that impact both avian health and human disease models.

What expression systems are optimal for producing functional recombinant chicken AGTR1?

Producing functional recombinant chicken AGTR1 presents unique challenges due to its nature as a seven-transmembrane G-protein coupled receptor. Mammalian expression systems, particularly HEK293 and CHO cells, generally yield the highest quality recombinant chicken AGTR1 with proper folding and post-translational modifications essential for ligand binding and signaling functionality . These systems provide the appropriate cellular machinery for correct insertion into the plasma membrane and glycosylation patterns. Alternatively, insect cell systems (Sf9, Sf21) using baculovirus vectors offer advantages for larger-scale production while maintaining most post-translational modifications. For structural studies requiring higher protein yields, specialized strains like Pichia pastoris can be employed, though additional refolding and validation steps may be necessary. Bacterial systems are generally unsuitable for full-length functional AGTR1 due to the lack of appropriate membrane insertion machinery and post-translational modification capabilities, though they may be useful for producing specific domains for antibody generation. Regardless of the chosen system, expression constructs should include affinity tags (His, FLAG, etc.) positioned to avoid interference with ligand binding domains, and codon optimization for the expression host improves yields substantially.

What purification strategies maintain the structural integrity of membrane-bound recombinant AGTR1?

Maintaining structural integrity during purification represents a critical challenge for membrane-bound proteins like AGTR1. Effective purification begins with careful solubilization using detergents that preserve receptor functionality—typically mild non-ionic detergents such as n-dodecyl-β-D-maltoside (DDM) or digitonin at concentrations just above their critical micelle concentration . For affinity purification, immobilized metal affinity chromatography (IMAC) using nickel or cobalt resins works effectively for His-tagged constructs, while anti-FLAG affinity gels work well for FLAG-tagged proteins. Throughout the purification process, maintaining a stable lipid environment through the addition of cholesterol hemisuccinate or phospholipids helps preserve native conformation. Size exclusion chromatography as a final purification step separates monomeric receptors from aggregates and provides a means to assess protein homogeneity. For applications requiring detergent removal, reconstitution into nanodiscs or lipid bilayer particles using membrane scaffold proteins offers advantages for maintaining functionality. Quality control assessments should include ligand binding assays with radiolabeled angiotensin II to confirm that the purified receptor retains its pharmacological properties, as structural perturbations during purification often manifest as reduced binding affinity or altered signaling capacity.

What assays can effectively measure AGTR1 signaling activity in chicken cell systems?

Several complementary assays can effectively measure AGTR1 signaling activity in chicken cell systems. Calcium flux assays using fluorescent calcium indicators (Fluo-4, Fura-2) provide real-time measurement of one of the primary second messengers in AGTR1 signaling . For analyzing downstream kinase activation, phospho-specific antibodies against ERK1/2 in Western blotting or ELISA formats offer quantitative assessment of signal transduction efficiency. Inositol phosphate accumulation assays using radiolabeled precursors or ELISA-based detection kits directly measure the production of inositol trisphosphate following AGTR1 activation. For more comprehensive pathway analysis, reporter gene assays incorporating response elements regulated by transcription factors downstream of AGTR1 signaling provide integrated measurements of receptor function. In primary chicken vascular smooth muscle cells or cardiomyocytes, contractility assays using cell dimension tracking or force transducers offer physiologically relevant functional readouts. These methodological approaches can be applied comparatively to wild-type and variant AGTR1 to assess how genetic polymorphisms affect signaling dynamics, providing mechanistic insights into phenotypic differences observed in different chicken populations.

How can researchers develop and validate antagonists specific to chicken AGTR1?

Developing chicken-specific AGTR1 antagonists requires a systematic approach combining in silico, in vitro, and cell-based methods. The process begins with comparative homology modeling of chicken AGTR1 based on crystallized mammalian GPCR structures, followed by virtual screening of compound libraries against the predicted angiotensin II binding pocket . Promising candidates identified through docking simulations proceed to in vitro competitive binding assays using radiolabeled angiotensin II and membrane preparations expressing recombinant chicken AGTR1. Compounds demonstrating high binding affinity undergo functional characterization in cell-based assays measuring calcium flux, ERK phosphorylation, and other downstream signaling events to confirm antagonistic activity. Structure-activity relationship studies guide chemical optimization of lead compounds for improved potency and selectivity. Species selectivity assessment requires parallel testing against mammalian AGTR1 orthologs to identify compounds with preferential activity toward the chicken receptor. Pharmacokinetic evaluation in chickens determines bioavailability and tissue distribution, while ex vivo organ bath studies with chicken vascular tissue validate physiological antagonism. Final validation involves in vivo testing in chicken models of AGTR1-mediated pathologies, such as experimentally induced ascites, to confirm target engagement and efficacy. This comprehensive approach ensures development of antagonists with appropriate specificity and activity for research applications.

What selective pressures might explain the high fixation rate of AGTR1 variants in commercial chicken lines?

The remarkably high fixation rate of AGTR1 variants in commercial chicken lines (AF WL = 0.98, AF BL = 0.98, AF BR = 0.86) indicates intense selective pressure acting on this locus during modern poultry breeding . Several complementary factors likely contribute to this pattern. First, selection for rapid growth rate in broilers created unprecedented cardiovascular demands, potentially favoring AGTR1 variants that optimize blood pressure regulation and vascular development under these conditions. Second, the confined environment of modern production systems eliminated many natural selective pressures while introducing novel stressors, shifting the fitness landscape for cardiovascular regulatory genes. Third, ascites (pulmonary arterial hypertension) emerged as a significant cause of mortality in rapidly growing broilers, creating strong selection against susceptibility alleles at AGTR1 and other loci affecting pulmonary vascular tone . Fourth, the relatively small effective population size in commercial breeding programs accelerated the fixation of beneficial alleles through genetic drift and hitchhiking effects with other selected traits. The timing of AGTR1 fixation appears relatively recent based on population genetic analyses, consistent with intensification of production practices rather than early domestication events . This example illustrates how modern breeding programs can drive rapid evolutionary change at specific loci when strong artificial selection intersects with novel physiological challenges.

How can insights from chicken AGTR1 research inform understanding of cardiovascular and metabolic disorders in other species?

Research on chicken AGTR1 provides valuable translational insights for understanding cardiovascular and metabolic disorders across species. The association between AGTR1 variants and ascites (pulmonary arterial hypertension) in broiler chickens offers a naturally occurring model for studying similar conditions in humans and other mammals . Rapidly growing broilers experience pulmonary vascular remodeling under physiological stress that parallels aspects of human PAH pathophysiology, allowing investigation of genetic predispositions and environmental triggers in a controlled system. Beyond pulmonary hypertension, chicken models bring unique advantages for studying AGTR1's role in metabolic adaptation, as modern commercial lines have undergone intense selection for growth and feed efficiency traits that interact with cardiovascular regulation. Comparative studies between layer and broiler lines with different AGTR1 allele frequencies can illuminate how receptor variants influence the integration of cardiovascular function with metabolic demands . Additionally, the relatively recent fixation of AGTR1 variants in commercial chickens provides an opportunity to study gene-environment interactions during adaptive evolution—a pattern with parallels in human populations experiencing rapid dietary and lifestyle transitions. These cross-species perspectives enhance our understanding of AGTR1 biology in both normal physiology and pathological states across taxa.

What model systems can effectively translate findings between chicken AGTR1 research and mammalian cardiovascular studies?

Several innovative model systems facilitate effective translation between chicken AGTR1 research and mammalian cardiovascular studies. Chimeric receptor approaches, where domain-swapping between chicken and mammalian AGTR1 creates hybrid constructs, help identify species-specific functional elements and conserved signaling mechanisms when expressed in standardized cell systems. The developing chicken embryo provides an accessible system for in vivo cardiovascular studies through windowing techniques, allowing real-time imaging of vascular development and function while manipulating AGTR1 activity through pharmacological or genetic approaches . For specific disease models, the chicken-wire Ascites Model (CWAM), which induces pulmonary hypertension through a combination of cool temperatures and dietary factors, creates a controlled system for testing AGTR1-targeted interventions potentially applicable to human PAH . Organoid technologies offer another translational platform, where chicken or mammalian vascular cells can be cultured in three-dimensional systems incorporating recombinant AGTR1 variants to study receptor function in a tissue-like context. Finally, CRISPR-Cas9 genome editing in both avian and mammalian systems enables precise engineering of equivalent AGTR1 mutations across species, allowing direct functional comparison of conserved variants. These complementary approaches collectively enhance the translational value of findings between avian and mammalian systems, leveraging the unique advantages of each to advance cardiovascular research.

How might single-cell transcriptomics enhance our understanding of AGTR1 expression patterns in chicken tissues?

Single-cell transcriptomics represents a revolutionary approach for mapping AGTR1 expression with unprecedented resolution in chicken tissues. This technology can reveal previously unrecognized cellular heterogeneity in AGTR1 expression, identifying specialized cell populations within tissues that may serve as primary mediators of angiotensin II effects . In the pulmonary vasculature, single-cell analysis could distinguish between endothelial, smooth muscle, and fibroblast subpopulations with differential AGTR1 expression, potentially explaining variable responsiveness to hypoxic conditions associated with ascites development . Beyond static expression patterns, single-cell approaches can capture dynamic transcriptional changes during developmental processes or disease progression, offering insights into the temporal regulation of AGTR1 in relation to other components of the renin-angiotensin system. Comparative single-cell analyses between different chicken breeds or between normal and pathological tissues could identify co-expression networks and cellular contexts that modulate AGTR1 function. Integration with spatial transcriptomics would further enhance these insights by preserving information about the anatomical distribution of AGTR1-expressing cells, particularly at critical interfaces such as vascular branch points or tissue boundaries where receptor signaling may play specialized roles in morphogenesis or homeostatic regulation.

How can CRISPR-Cas9 genome editing be optimized for studying AGTR1 function in chicken models?

Optimizing CRISPR-Cas9 genome editing for studying AGTR1 function in chicken models requires addressing several technical challenges unique to avian systems. The most efficient approach involves editing primordial germ cells (PGCs) in vitro, followed by reintroduction into recipient embryos to generate germline chimeras . For AGTR1 specifically, careful guide RNA design must account for chicken-specific genomic features such as GC content and potential off-target sites, with multiple guide RNAs targeting different exons recommended for higher success rates. Delivery methods combining lipofection for transient expression with puromycin selection markers have shown superior efficiency in chicken PGCs compared to viral vectors. When designing edits, researchers should consider creating both knockout alleles for complete loss-of-function studies and precise point mutations that mimic naturally occurring variants identified in different chicken populations . Validation of edits requires comprehensive approaches including sequencing, mRNA expression analysis, and protein quantification, as compensatory mechanisms may mask phenotypic effects. For functional characterization, targeted edits in regions encoding the angiotensin II binding domain or G-protein coupling interface provide specific insights into receptor signaling mechanisms. Additionally, conditional editing systems using inducible promoters enable temporal control of AGTR1 disruption, particularly valuable for studying developmental roles versus adult physiological functions. These methodological refinements collectively enhance the precision and interpretability of genome editing approaches for investigating AGTR1 biology in avian systems.

What novel biomarkers could indicate altered AGTR1 function in chicken cardiovascular physiology?

Innovative biomarkers for altered AGTR1 function in chicken cardiovascular physiology span multiple biological levels and technological platforms. At the genetic level, targeted sequencing panels can rapidly identify known functional variants in AGTR1 and related pathway genes, providing predictive information about receptor activity . Transcriptomic biomarkers include not only AGTR1 mRNA levels but also expression ratios of genes in compensatory pathways, such as ACE2/Ang(1-7)/MasR axis components, which often show reciprocal regulation. Proteomic approaches have identified post-translational modifications of AGTR1, including phosphorylation patterns reflecting receptor activation status, which can be detected in tissue samples using phospho-specific antibodies . Metabolomic signatures downstream of AGTR1 activation, particularly phosphoinositide derivatives and products of oxidative stress, offer non-invasive indicators measurable in blood samples. Functional biomarkers include echocardiographic parameters such as pulmonary artery pressure and right ventricular dimensions, which correlate with AGTR1-mediated vascular tone particularly relevant to ascites susceptibility . Emerging technologies like wearable sensors capable of continuous cardiovascular monitoring in production environments could revolutionize early detection of AGTR1-related physiological changes. Integration of these multi-level biomarkers through machine learning approaches promises more sensitive and specific detection of altered AGTR1 function, potentially enabling early intervention before clinical manifestations of cardiovascular pathologies in commercial poultry operations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.