Recombinant Chicken Type I iodothyronine deiodinase (DIO1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify any format requirements in your order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and confirmed in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your use.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If a specific tag type is required, please inform us during your order; we will prioritize development to meet your specifications.
Synonyms
DIO1; Type I iodothyronine deiodinase; 5DI; DIOI; Type 1 DI; Type-I 5'-deiodinase; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-245
Protein Length
full length protein
Species
Gallus gallus (Chicken)
Target Names
DIO1
Target Protein Sequence
LSIRVLLHKLLILLQVTLSVVVGKTMMILFPDTTKRYILKLGEKSRMNQNPKFSYENWGP TFFSFQYLLFVLKVKWRRLEDEAHEGRPAPNTPVVALNGEMQHLFSFMRDNRPLILNFGS CTUPSFMLKFDEFNKLVKDFSSIADFLIIYIEEAHAVDGWAFRNNVVIKNHRSLEDRKTA AQFLQQKNPLCPVVLDTMENLSSSKYAALPERLYILQAGNVIYKGGVGPWNYHPQEIRAV LEKLK
Uniprot No.

Target Background

Function
This recombinant chicken Type I iodothyronine deiodinase (DIO1) is responsible for the deiodination of thyroxine (T4) to triiodothyronine (T3) and the subsequent deiodination of T3 to 3,3'-diiodothyronine (T2).
Gene References Into Functions
  1. In day-old chicks, deiodinase is localized to the internal granule cells of the cerebellum; at this stage, migration of immature granule cells from the external to internal layer is complete. Hypothyroidism retards this cell migration. PMID: 15062548
Database Links

KEGG: gga:395940

STRING: 9031.ENSGALP00000017451

UniGene: Gga.553

Protein Families
Iodothyronine deiodinase family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein.

Q&A

What is the functional role of Type I iodothyronine deiodinase (DIO1) in chicken thyroid hormone metabolism?

Chicken DIO1 serves as a key enzyme in thyroid hormone regulation through two distinct catalytic activities:

  • Outer ring deiodination (ORD): Converts the prohormone thyroxine (T4) to bioactive 3,3',5-triiodothyronine (T3), activating thyroid hormone signaling

  • Inner ring deiodination (IRD): Converts T3 to inactive diiodothyronine (T2), functioning as an inactivation pathway

This dual functionality distinguishes DIO1 from other deiodinase isoenzymes, as DIO2 only catalyzes outer ring deiodination while DIO3 only catalyzes inner ring deiodination . DIO1 is predominantly expressed in the liver and kidneys, making these tissues critical regulatory centers for systemic thyroid hormone levels .

How does the amino acid sequence of chicken DIO1 compare to mammalian DIO1 proteins?

Chicken DIO1 shows moderate sequence conservation with mammalian counterparts while maintaining nearly identical functional properties:

  • The chicken DIO1 amino acid sequence shares 61% homology with human DIO1

  • Contains 249 amino acids in the open reading frame

  • Features a catalytically essential selenocysteine (Sec) residue at position 126, encoded by a UGA codon that typically signals translation termination

  • Contains a selenocysteine insertion sequence (SECIS) in the 3' UTR that allows for Sec incorporation

  • Includes highly conserved amino acid sequences (NFGSCTSecP and YIEEAH) that are critical for catalytic function across vertebrate species

Despite the moderate sequence homology, functional studies demonstrate that chicken DIO1 exhibits identical substrate specificity and inhibitor sensitivity as human and rat enzymes, highlighting the evolutionary conservation of catalytic features .

What are the essential catalytic residues in chicken DIO1 and how do they function?

The catalytic mechanism of chicken DIO1 depends on several key residues that work cooperatively:

  • Selenocysteine (Sec126): The primary catalytic residue that directly interacts with iodothyronine substrates, abstracting iodine during the deiodination reaction

  • Cysteine 124: Forms a selenenyl-sulfide bond with Sec126 during catalysis, which becomes the substrate for the physiological reductant glutathione

  • Proton relay pathway residues: A network of amino acids that facilitates proton transfer during catalysis, including:

    • Ser123: Contributes to but is not essential for activity

    • Thr125: Provides a critical hydroxyl group essential for deiodination

    • Glu156: Likely participates in proton transfer

    • His174: Exposed to solvent, believed to receive protons during the reaction

    • Tyr153: Stabilizes the hydrogen-bonded network

Mutagenesis studies have confirmed that the hydroxyl function of Thr125 is absolutely essential for activity, as the T125A mutation completely abolishes enzyme function, while T125S retains nearly wild-type activity. This supports the existence of a conserved proton relay network in deiodinases across species .

What are the optimal expression systems for producing functional recombinant chicken DIO1?

The expression of functional recombinant chicken DIO1 presents unique challenges due to its selenoprotein nature. Several expression systems have been evaluated, each with distinct advantages:

  • Mammalian Cell Systems:

    • COS-1 and COS-7 cells have been successfully used to express chicken DIO1

    • These systems contain the necessary machinery for selenocysteine incorporation

    • Require proper engineering of the start codon and selenocysteine insertion sequence (SECIS) element

    • Typical yields are sufficient for functional studies but limited for structural analysis

  • Insect Cell Systems:

    • High5 insect cells with baculoviral transduction can produce higher yields

    • Lack selenoprotein synthesis machinery, requiring Sec126 to be replaced with cysteine (U126C)

    • This substitution typically results in reduced but detectable activity

  • Optimized Expression Constructs:

    • For chicken DIO1, the ECL1711 clone initially lacked a proper translation start site

    • Site-directed mutagenesis was used to introduce an ATG codon in a Kozak consensus sequence

    • The resulting mutant (ECL1711M) expressed high deiodinase activity in COS-1 cells

A comparative analysis of expression yields in different systems showed that mammalian expression is preferable when native activity is required, while insect cell systems may be advantageous when protein quantity is prioritized over maintaining full catalytic efficiency.

How can researchers efficiently incorporate selenocysteine into recombinant chicken DIO1?

Successful incorporation of selenocysteine (Sec) is critical for obtaining catalytically active DIO1. The following methodological approaches have proven effective:

  • Vector Design Requirements:

    • Include the UGA codon at position 126 in the coding sequence

    • Incorporate the complete selenocysteine insertion sequence (SECIS) element from the 3' UTR

    • Maintain the proper spacing between the UGA codon and SECIS element

  • Selenocysteine Incorporation Enhancement:

    • Supplement culture media with selenium (typically as sodium selenite)

    • Co-express selenocysteine synthesis machinery components if needed

    • Optimize codon usage for the expression system

  • Alternative Approaches:

    • Sec126Cys substitution for systems lacking selenoprotein synthesis machinery

    • This substitution typically results in lower but measurable activity

    • Enables higher expression yields in bacterial or insect cell systems

In the study of chicken DIO1, researchers successfully engineered an ATG start codon in the ECL1711 clone by site-directed mutagenesis, creating the ECL1711M mutant that expressed high deiodinase activity in COS-1 cells, demonstrating that the properly designed construct can achieve effective selenocysteine incorporation .

What purification strategies maintain optimal activity of recombinant chicken DIO1?

Purification of recombinant chicken DIO1 requires strategies that accommodate its membrane-associated nature and preserve the reactive selenocysteine residue:

  • Membrane Fraction Isolation:

    • Initial separation of membrane fractions containing the recombinant enzyme

    • Typically involves cell lysis followed by differential centrifugation

    • Can be used directly for activity assays or further purified

  • Affinity Purification Approaches:

    • Addition of affinity tags (e.g., His-tag, FLAG-tag) facilitates purification

    • C-terminal 8xHis-tag preceded by an enterokinase cleavage site has been successful

    • Position tags to avoid interference with membrane insertion or catalytic function

  • Critical Buffer Components:

    • Maintain reducing conditions throughout purification (e.g., DTT, β-mercaptoethanol)

    • Include protease inhibitors to prevent degradation

    • Consider detergent selection carefully for membrane protein solubilization

  • Storage Conditions for Maintaining Activity:

    • Store with reducing agents to prevent selenocysteine oxidation

    • Include glycerol (typically 10-20%) to prevent freeze-thaw damage

    • Store at -80°C for long-term preservation of activity

The reactive nature of the selenocysteine residue makes DIO1 particularly susceptible to oxidative inactivation, making the maintenance of reducing conditions throughout purification and storage essential for preserving enzymatic activity.

What are the optimal substrates and conditions for measuring chicken DIO1 activity?

Accurate measurement of chicken DIO1 activity requires careful selection of substrates and reaction conditions:

  • Preferred Substrates (in order of reactivity):

    • Reverse T3 (rT3) - highest reactivity

    • T3 sulfate (T3S)

    • Thyroxine (T4)

    • Triiodothyronine (T3) - lowest reactivity

  • Standard Assay Conditions:

    • Substrate concentrations: typically 0.1-1 μM (Km for rT3 is approximately 0.26 μM)

    • Buffer: commonly phosphate buffer (pH 7.0-7.4)

    • Reducing agent: 10-20 mM DTT for maximum activity

    • Temperature: usually 37°C

    • Reaction time: typically 30-60 minutes (ensure linearity)

  • Detection Methods:

    • Radiometric assays using 125I-labeled substrates are the gold standard

    • HPLC-based methods for detection of deiodinated products

    • Colorimetric or fluorometric detection of released iodide

The substrate preference profile of chicken DIO1 (rT3 > T3S > T4 > T3) is identical to that observed in native chicken liver microsomes, confirming that recombinant enzyme accurately reflects the properties of the native enzyme .

How do different reducing systems affect chicken DIO1 activity?

The catalytic cycle of DIO1 requires regeneration of the active enzyme through reduction of oxidized intermediates. Different reducing systems affect activity in distinct ways:

Reducing SystemEffectiveness with Chicken DIO1Concentration RangePhysiological Relevance
Dithiothreitol (DTT)High - standard for in vitro assays10-20 mMNon-physiological
Glutathione (GSH)Moderate - requires Cys1241-10 mMPrimary physiological reductant
Thioredoxin systemLow with Sec126Cys mutant1-5 μM Trx + 0.1 μM TrxR + 200 μM NADPHPotential physiological reductant
Glutaredoxin systemModerate with Sec126Cys mutant1 μM Grx + 1 mM GSHPotential physiological reductant

Mechanistic studies have shown that the proximal Cys124 forms a selenenyl-sulfide with the catalytic Sec126 during catalysis, which serves as the substrate for glutathione-mediated reduction. Mutation of Cys124 prevents reduction by glutathione while still allowing reduction by DTT, indicating distinct reduction pathways .

What inhibitors are useful for characterizing chicken DIO1 and distinguishing it from other deiodinases?

Selective inhibitors are valuable tools for studying chicken DIO1 and differentiating its activity from other deiodinase isoforms:

InhibitorIC50 for Chicken DIO1SelectivityMechanism of Action
Propylthiouracil (PTU)~30 μMSelective for DIO1Competitive with reducing agent, uncompetitive with substrate
Iodoacetate (IAc)~30 μMInhibits all deiodinasesAlkylates selenocysteine/cysteine residues
Gold thioglucose (GTG)Nanomolar rangeInhibits all deiodinasesInteracts with selenolate or thiolate groups
Iopanoic acidMicromolar rangeInhibits all deiodinasesCompetitive with substrate binding

PTU sensitivity is a distinguishing feature of DIO1 across species, making it particularly useful for differentiating DIO1 activity from DIO2 and DIO3 in mixed samples. The inhibition profiles of these compounds on recombinant chicken DIO1 are identical to their effects on native chicken DIO1 in embryonic day 19 (E19) liver microsomes, confirming the recombinant protein's authenticity .

How can researchers differentiate between DIO1, DIO2, and DIO3 activities in chicken tissue samples?

Distinguishing between the three deiodinase isoenzymes in chicken tissues requires a multi-faceted approach exploiting their distinct biochemical characteristics:

  • Substrate and Reaction Specificity:

    • DIO1: Catalyzes both ORD and IRD (measure both T4→T3 and T3→T2 conversion)

    • DIO2: Catalyzes only ORD (measure only T4→T3 conversion)

    • DIO3: Catalyzes only IRD (measure only T3→T2 conversion)

  • Inhibitor Sensitivity Profile:

    • PTU sensitivity: DIO1 is inhibited by 30 μM PTU, while DIO2 and DIO3 are resistant

    • Assay samples with and without PTU to quantify DIO1 contribution

    • All three enzymes are inhibited by iopanoic acid and gold thioglucose

  • Kinetic Characteristics:

    • DIO1: Higher Km values (μM range), ping-pong kinetics

    • DIO2: Lower Km values (nM range), sequential kinetics

    • Compare reaction rates at low vs. high substrate concentrations

  • Tissue Distribution Analysis:

    • DIO1: Predominantly in liver and kidney

    • DIO2: Brain, pituitary, brown adipose tissue

    • DIO3: Embryonic tissues, placenta, brain

    • Combine with above methods for definitive identification

A comprehensive differentiation protocol might include parallel assays measuring both ORD and IRD activities at multiple substrate concentrations in the presence and absence of PTU, enabling quantitative attribution of activity to each deiodinase isoform.

How do the kinetic properties of chicken DIO1 compare to mammalian DIO1 enzymes?

Despite 39% sequence divergence from human DIO1, chicken DIO1 exhibits remarkably similar kinetic properties to mammalian orthologs:

ParameterChicken DIO1Mammalian DIO1Significance
Substrate preferencerT3 > T3S > T4 > T3rT3 > T3S > T4 > T3Conserved substrate recognition
Km for rT3~0.26 μM0.1-0.5 μMSimilar substrate affinity
Reaction kineticsPing-pong mechanismPing-pong mechanismConserved catalytic mechanism
PTU sensitivityIC50 ~30 μMIC50 10-50 μMConserved inhibitor binding site
Deiodination catalysisBoth ORD and IRDBoth ORD and IRDConserved bifunctional activity

Functional studies of recombinant chicken DIO1 conclusively demonstrated identical substrate specificity and inhibitor sensitivity as human and rat enzymes . This high degree of functional conservation despite moderate sequence divergence highlights the fundamental importance of DIO1 in vertebrate thyroid hormone regulation and suggests strong evolutionary pressure to maintain its catalytic properties.

What structural features distinguish chicken DIO1 from other deiodinase isoenzymes?

Chicken DIO1 possesses several structural features that distinguish it from DIO2 and DIO3, while sharing key catalytic elements common to all deiodinases:

  • Common Features Across Deiodinases:

    • Thioredoxin-fold structure

    • Membrane-anchored, homodimeric selenoproteins

    • Catalytic selenocysteine residue embedded in a conserved motif

  • DIO1-Specific Features:

    • Bifunctional catalytic capability (both ORD and IRD)

    • PTU-sensitive active site configuration

    • Unique residues that facilitate dual substrate orientation

    • Conserved Phe65 (or equivalent) important for rT3 binding

  • Substrate Binding Pocket Differences:

    • DIO1: Accommodates substrates in orientations allowing both inner and outer ring deiodination

    • DIO2: Outer ring-specific orientation

    • DIO3: Inner ring-specific orientation

The catalytic domains of all three deiodinase isoenzymes share a common structural fold, with specific amino acid differences that determine their distinct substrate specificities and catalytic properties. Recent structural studies of mouse DIO2 catalytic domain provide valuable insights that can be extended to understanding chicken DIO1 structure through homology modeling .

How has DIO1 evolved across vertebrate species, and what does this tell us about thyroid hormone regulation?

The evolutionary analysis of DIO1 across vertebrates reveals important insights about thyroid hormone metabolism:

  • Sequence Conservation Patterns:

    • Catalytic selenocysteine and surrounding motifs show highest conservation

    • Chicken DIO1 shares 61% amino acid identity with human DIO1

    • Substrate specificity and inhibitor sensitivity remain nearly identical despite sequence divergence

  • Species Distribution:

    • DIO1 has been identified across diverse vertebrates including:

      • Mammals: human, mouse, rat, horse, dog, cow, guinea pig, naked mole-rat, rabbit, cat, sheep

      • Birds: chicken

      • Fish: zebrafish, killifish

    • Consistent presence suggests fundamental importance in vertebrate physiology

  • Functional Adaptation:

    • The bifunctional nature of DIO1 (both activating and inactivating) appears to be an ancient characteristic

    • May provide a more versatile regulation of thyroid hormone levels compared to the specialized DIO2 and DIO3

    • Conservation of liver and kidney expression patterns suggests maintained role in systemic hormone regulation

The strong functional conservation of DIO1 across diverse species that diverged over 300 million years ago highlights the fundamental importance of regulated thyroid hormone metabolism in vertebrate development, metabolism, and homeostasis.

How can site-directed mutagenesis elucidate the catalytic mechanism of chicken DIO1?

Site-directed mutagenesis provides powerful insights into structure-function relationships in chicken DIO1:

  • Proton Relay Pathway Analysis:

    • Systematic mutation of proposed hydrogen-bonding residues:

      • Ser123→Ala: Reduced activity but not abolished

      • Thr125→Ala: Complete loss of activity

      • Thr125→Ser: Nearly wild-type activity

    • Results confirm the essential role of the Thr125 hydroxyl group in proton transfer during catalysis

  • Redox Cycle Investigation:

    • Mutation of Cys124 prevents reduction by glutathione while DTT can still regenerate the enzyme

    • Demonstrates that Cys124 forms a selenenyl-sulfide with Sec126 during catalysis

    • This intermediate is specifically reduced by physiological glutathione

  • Substrate Specificity Determinants:

    • Mutation of residues like Phe65 affects ORD of rT3 specifically

    • Suggests interaction between aromatic ring and mono-substituted inner ring of rT3

  • Expression Optimization:

    • Engineering an ATG start codon in a Kozak consensus sequence (creating ECL1711M)

    • Resulted in functional expression in COS-1 cells with identical substrate preference as native enzyme

These mutagenesis studies have collectively revealed that chicken DIO1 employs a catalytic mechanism where selenocysteine abstracts iodine from the substrate, followed by proton transfer via a hydrogen-bonded network, and enzyme regeneration through reduction of selenenyl-sulfide intermediates.

What mass spectrometry approaches can reveal about chicken DIO1 reaction intermediates?

Advanced mass spectrometry techniques offer unprecedented insights into DIO1 catalytic mechanisms:

  • Identification of Catalytic Intermediates:

    • LC-MS/MS analysis has demonstrated the formation of a selenenyl-sulfide bond between Cys124 and Sec126 during catalysis

    • This critical intermediate serves as the substrate for physiological reductants

  • Protein-Protein Interaction Analysis:

    • Cross-linking MS can identify:

      • Homodimer interface residues

      • Potential interactions with other proteins in the deiodinase complex

    • MS³ fragmentation techniques enhance identification of cross-linked peptides

  • Post-Translational Modification Mapping:

    • Detection of selenocysteine oxidation states

    • Identification of other modifications affecting activity

    • Analysis of potential regulatory phosphorylation sites

  • Structural Analysis Approaches:

    • Hydrogen-deuterium exchange MS can probe conformational dynamics

    • Native MS can examine oligomeric states and protein complex formation

    • Limited proteolysis coupled with MS can identify flexible regions and domain boundaries

Mass spectrometry studies have already revealed critical insights about deiodinase mechanism, particularly demonstrating the formation of an intracellular disulfide between Cys124 and Sec126 side chains during catalysis . This mechanistic understanding enables design of more effective inhibitors and development of engineered deiodinases with modified catalytic properties.

What crystallization strategies are most promising for structural studies of chicken DIO1?

Structural characterization of chicken DIO1 presents unique challenges that require specialized approaches:

  • Addressing Membrane Protein Challenges:

    • Detergent screening to identify optimal solubilization conditions

    • Lipid cubic phase crystallization, which provides a membrane-like environment

    • Nanodiscs or amphipols to stabilize the membrane-associated domains

  • Protein Engineering for Crystallization:

    • Removal of flexible regions that may impede crystal formation

    • Fusion with crystallization chaperones (e.g., T4 lysozyme, BRIL)

    • Surface entropy reduction through mutation of surface lysine and glutamate clusters

  • Selenocysteine-Specific Considerations:

    • Maintaining reducing conditions throughout purification and crystallization

    • Site-directed mutagenesis (Sec126Cys) may enhance stability

    • Co-crystallization with inhibitors to stabilize the active site

  • Alternative Structural Approaches:

    • Cryo-electron microscopy for membrane protein structures

    • Small-angle X-ray scattering for solution structure and conformational states

    • NMR spectroscopy for dynamic regions and ligand interactions

How can systems biology approaches integrate DIO1 function into thyroid hormone signaling networks?

Understanding DIO1 within the broader context of thyroid hormone regulation requires integrative approaches:

  • Multi-Omics Integration:

    • Combine transcriptomics, proteomics, and metabolomics data

    • Map changes in DIO1 expression/activity to:

      • Thyroid hormone metabolite profiles

      • Downstream gene expression responses

      • Metabolic pathway alterations

  • Network Modeling Approaches:

    • Construct mathematical models of thyroid hormone activation/inactivation networks

    • Incorporate tissue-specific DIO1 expression patterns

    • Simulate effects of perturbations on systemic and local T3 levels

  • Advanced Genetic Manipulation:

    • CRISPR/Cas9 genome editing to:

      • Create chicken DIO1 knockout or knockin models

      • Introduce reporter tags for live-cell imaging

      • Engineer mutations that affect specific aspects of enzyme function

  • Physiological Context Studies:

    • Correlate DIO1 activity with:

      • Developmental stage-specific requirements

      • Tissue-specific thyroid hormone signaling

      • Response to physiological challenges (fasting, cold exposure)

  • Integration with Clinical Data:

    • Compare chicken and human DIO1 function to understand:

      • Evolutionary conservation of regulatory mechanisms

      • Potential implications for thyroid disorders

      • Pharmacological targeting strategies

Systems biology approaches reveal that DIO1 functions not merely as an isolated enzyme but as a critical node in complex regulatory networks controlling local and systemic thyroid hormone levels. These integrative methods help explain how seemingly modest alterations in deiodinase function can have significant physiological consequences through network effects .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.