Recombinant Chicken Ubiquitin-associated domain-containing protein 2 (UBAC2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C; lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
UBAC2; PHGDHL1; RCJMB04_16f18; Ubiquitin-associated domain-containing protein 2; UBA domain-containing protein 2; Phosphoglycerate dehydrogenase-like protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
35-344
Protein Length
Full Length of Mature Protein
Species
Gallus gallus (Chicken)
Target Names
UBAC2
Target Protein Sequence
QHYQKFFAYNLQAIKEDFQIWRLVCGRVICLDLKDTFCSSLLIYNFRIFERRYGSRKFSS FLLGAWTLSALFDLLLVEAAQYVFGITINSLPSGFLGPVFALFVPFYCSIPRVQVTQVLG YFSITNKTLVYILGLQLLTSGSYIWILALSGLISGICYNSSILKVHRILCVPSWVAKIFS WTLEPIFSSAEPTNEIRVGMGATVDIQRQQRMELLDRQIMMSQVAQMRRQRQQQGGMINW NRLFPPLRHRHNENYQDHHPSDQDTPPPTEVSEEQVARLMEMGFSRGDALEALRASNNDL NVATNFLLQH
Uniprot No.

Target Background

Function

UBAC2 restricts the trafficking of FAF2 from the endoplasmic reticulum to lipid droplets. It may also negatively regulate canonical Wnt signaling in lymphocytes.

Database Links
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is UBAC2 and what are its primary structural features?

UBAC2 (Ubiquitin-associated domain-containing protein 2) is an endoplasmic reticulum (ER) resident protein that plays a crucial role in ER homeostasis. In humans, the canonical protein has 344 amino acid residues with a molecular mass of approximately 39 kDa . The protein contains three transmembrane domains and is primarily localized to the ER membrane . UBAC2 harbors a highly conserved LC3-interacting region (LIR) in its cytoplasmic domain, which enables binding to autophagosomal GABARAP and facilitates its function in ER-phagy . The chicken UBAC2 protein spans residues 35-344 and contains sequence regions important for its functional activities including the LIR motif necessary for autophagy interactions .

What is the physiological role of UBAC2 in cellular homeostasis?

UBAC2 functions as a receptor for ER-phagy, a selective form of autophagic degradation that removes ER fragments to maintain ER homeostasis . Upon ER stress or autophagy activation, UBAC2 undergoes phosphorylation by microtubule affinity-regulating kinase 2 (MARK2) at serine 223, which promotes its dimerization . This dimerized form interacts more strongly with GABARAP, facilitating the selective degradation of ER components . Through this mechanism, UBAC2 plays an essential role in restraining inflammatory responses associated with ER stress and the unfolded protein response (UPR) . Notably, UBAC2 deficiency disrupts ER homeostasis, leading to increased inflammatory responses and exacerbated pathology in experimental models of inflammatory conditions like ulcerative colitis .

What are the optimal expression systems for producing recombinant UBAC2?

For efficient production of recombinant UBAC2, a ubiquitin fusion expression system has proven highly effective for similar proteins . This approach utilizes bacterial expression with a construct containing a 6×His-tagged ubiquitin (Ub) fused to the N-terminus of UBAC2. The system employs the catalytic core of ubiquitin-specific protease 2 (Usp2-cc) for precise cleavage at the Ub-UBAC2 junction, yielding the native N-terminus of UBAC2 . This method typically generates high yields of soluble protein from standard bacterial cultures without extensive optimization .

To implement this approach:

  • Generate a pHUE-UBAC2 construct with the full chicken UBAC2 sequence

  • Express in E. coli under standard induction conditions

  • Purify using immobilized metal affinity chromatography (IMAC)

  • Cleave with Usp2-cc (1:100 enzyme:substrate ratio)

  • Remove His-tagged components with Ni-NTA agarose

  • Verify purity by SDS-PAGE and activity by functional assays

This method has demonstrated success with various proteins of different sizes and complexities, making it suitable for UBAC2 expression .

What are the critical storage conditions for maintaining UBAC2 stability?

Recombinant chicken UBAC2 should be stored in a Tris-based buffer containing 50% glycerol optimized for protein stability . For short-term storage, the protein can be kept at 4°C for up to one week . For long-term preservation, store at -20°C, or preferably at -80°C for extended periods . Importantly, repeated freeze-thaw cycles should be avoided as they can compromise protein integrity and activity . Working aliquots should be prepared during initial processing to minimize freeze-thaw cycles.

Storage DurationRecommended TemperatureBuffer Composition
Short-term (≤1 week)4°CTris-based buffer, 50% glycerol
Medium-term-20°CTris-based buffer, 50% glycerol
Long-term-80°CTris-based buffer, 50% glycerol

How can researchers verify the functionality of recombinant UBAC2?

Verification of recombinant UBAC2 functionality should include multiple assays targeting different aspects of its biological activity:

  • GABARAP Binding Assay: Assess the interaction between UBAC2's LIR motif and GABARAP using pull-down assays or surface plasmon resonance, comparing binding before and after phosphorylation .

  • Phosphorylation Analysis: Evaluate MARK2-mediated phosphorylation at serine 223 using phospho-specific antibodies or mass spectrometry .

  • Dimerization Assessment: Analyze UBAC2 dimerization status using non-reducing SDS-PAGE, native gel electrophoresis, or size exclusion chromatography before and after phosphorylation .

  • ER-phagy Flux Assay: Measure the efficiency of ER-phagy using fluorescence-based assays like the RFP-KDEL-containing reporter system that monitors autophagic degradation of ER components . Research has shown that wild-type UBAC2 enhances autophagic degradation under starvation or ER stress conditions, while UBAC2 knockout cells exhibit reduced ER-phagy flux .

  • Protein Structural Integrity: Verify proper folding using circular dichroism or thermal shift assays compared to established standards.

How does UBAC2 phosphorylation regulate its function in ER-phagy?

UBAC2 undergoes a critical regulatory phosphorylation event mediated by microtubule affinity-regulating kinase 2 (MARK2) at serine 223 . This phosphorylation event serves as a molecular switch that promotes UBAC2 dimerization, substantially enhancing its interaction with autophagosomal GABARAP through the LC3-interacting region (LIR) . The strengthened UBAC2-GABARAP interaction accelerates ER-phagy progression, facilitating more efficient clearance of ER fragments under stress conditions .

To investigate this regulatory mechanism:

  • Generate phospho-mimetic (S223D/E) and phospho-deficient (S223A) UBAC2 mutants

  • Compare their dimerization status using native gel electrophoresis or crosslinking assays

  • Assess GABARAP binding affinity using co-immunoprecipitation or surface plasmon resonance

  • Measure ER-phagy flux using fluorescence-based reporter systems

  • Evaluate the impact on ER stress responses by measuring UPR markers

Research has demonstrated that phosphorylation-induced UBAC2 dimerization is essential for its function in restraining inflammatory responses associated with ER stress .

What is the relationship between UBAC2 dysfunction and inflammatory diseases?

UBAC2 serves as a critical negative regulator of inflammatory responses through its role in ER-phagy . Research has established important connections between UBAC2 dysfunction and inflammatory conditions:

  • Ulcerative Colitis: UBAC2 deficiency makes mice more susceptible to dextran sulfate sodium (DSS)-induced ulcerative colitis, with exacerbated tissue damage and inflammatory markers . UBAC2 knockout cells show increased ER stress and sterile inflammation.

  • Behçet's Disease: UBAC2 has been identified as a risk allele for Behçet's disease, with altered UBAC2 expression promoting disease progression .

  • Inflammatory Bowel Diseases: UBAC2 is highly correlated with the development of inflammatory bowel diseases, likely through its impact on ER homeostasis and inflammatory signaling .

  • Malignant Tumors: UBAC2 has been associated with skin and bladder cancer development, potentially through disruption of ER stress responses .

Mechanistically, UBAC2 variants or mutations in the LIR motif decrease ER-phagy flux and increase sterile inflammation associated with ER stress . This highlights the importance of proper UBAC2 function in maintaining balanced immune responses and suggests potential therapeutic approaches targeting this pathway.

How can experimental design overcome challenges in studying UBAC2 interactions?

Studying UBAC2 interactions presents several challenges due to its membrane localization, regulatory phosphorylation, and complex interaction network. A comprehensive experimental approach incorporating multiple independent variables and appropriate controls is essential . When designing experiments to investigate UBAC2:

  • Factorial Design Considerations: When testing multiple variables affecting UBAC2 function (e.g., phosphorylation status, dimerization, GABARAP binding, and ER stress), consider whether a complete factorial, fractional factorial, or individual experiments approach is most appropriate . For example, a 2³ factorial design examining phosphorylation, dimerization, and stress induction would require 8 experimental conditions.

  • Managing Aliasing: In reduced experimental designs, be aware that certain effects may be aliased or confounded . For instance, if using a fractional factorial design to study UBAC2, the main effect of phosphorylation might be aliased with specific interaction effects, leading to potential misinterpretation of results.

  • Proximity Labeling Approaches: Consider employing advanced proximity labeling techniques like PhastID (Pyrococcus horikoshii biotin protein ligase-assisted biotin identification) that have successfully identified UBAC2 as an ER-phagy receptor . This method can capture endogenous proteins on the ER membrane and identify transient interactions that might be missed by traditional approaches.

  • Complementary Methodologies: Combine structural, biochemical, and cellular approaches to validate findings, as each method has its own limitations and biases when studying membrane proteins like UBAC2.

How does chicken UBAC2 compare structurally and functionally to mammalian orthologs?

Chicken (Gallus gallus) UBAC2 shares significant structural and functional similarities with mammalian orthologs, though with some notable differences:

  • Sequence Conservation: The chicken UBAC2 protein contains the core functional regions present in mammalian UBAC2, including the LIR motif necessary for autophagy interactions and transmembrane domains for ER localization . The functional expression region spans amino acids 35-344, similar to the human canonical form with 344 amino acid residues .

  • Key Functional Domains: Analysis of the chicken UBAC2 amino acid sequence reveals conservation of critical domains:

    • Transmembrane domains for ER anchoring

    • UBA (ubiquitin-associated) domain for potential ubiquitin binding

    • LIR motif for interaction with autophagy machinery

  • Potential Phosphorylation Sites: While the exact conservation of the critical serine 223 phosphorylation site has not been explicitly verified in the provided data, the sequence contains multiple serine residues that could serve as regulatory phosphorylation sites .

For researchers, these similarities suggest that findings from chicken UBAC2 studies may provide valuable insights applicable to mammalian systems, while potential differences highlight the importance of species-specific validation.

What are the best methods for designing knockout or mutation studies of chicken UBAC2?

When designing knockout or mutation studies of chicken UBAC2, researchers should consider the following methodological approaches:

  • CRISPR-Cas9 Gene Editing:

    • Target conserved regions of the UBAC2 gene essential for function, such as the LIR motif or transmembrane domains

    • Design guide RNAs specific to the chicken UBAC2 sequence (gene name: UBAC2, synonym: PHGDHL1, ORF name: RCJMB04_16f18)

    • Verify knockout efficiency using both genomic sequencing and protein expression analysis

  • Point Mutation Design:

    • Create specific mutations based on known functional residues, such as those in the LIR motif or potential phosphorylation sites

    • For phosphorylation studies, generate S→A (phospho-deficient) and S→D/E (phospho-mimetic) mutations at candidate sites

    • Use site-directed mutagenesis with verification by sequencing

  • Functional Verification Assays:

    • ER-phagy flux measurement using fluorescent reporter systems similar to those used in human cell studies

    • GABARAP binding assays to assess autophagy pathway interaction

    • ER stress response measurements to evaluate physiological impact of mutations

  • Control Design Considerations:

    • Include wild-type controls processed in parallel

    • Generate rescue cell lines expressing wild-type UBAC2 to confirm phenotype specificity

    • Consider using different guide RNA targets or mutation approaches to exclude off-target effects

Previous studies have successfully used CRISPR-Cas9 to generate UBAC2 knockout cell lines that exhibited reduced ER-phagy flux under starvation-induced autophagy or ER stress conditions , providing a methodological framework for chicken UBAC2 studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.