Recombinant Chicken Uncharacterized protein KIAA1467 homolog (RCJMB04_14d19)

Shipped with Ice Packs
In Stock

Description

Molecular Classification and Nomenclature

The protein designated as KIAA1467 homolog in chicken belongs to a family of proteins that remain incompletely characterized across species. In mammals, particularly humans, the corresponding gene is known as FAM234B (family with sequence similarity 234 member B), with KIAA1467 serving as a synonym . The specific identifier "RCJMB04_14d19" represents the unique accession code assigned to this chicken homolog in genomic databases .

The nomenclature reflects the evolutionary conservation of this protein across various species, with homologs identified in multiple vertebrates. The "uncharacterized" designation highlights that despite its conservation, the precise biological functions and molecular mechanisms of this protein remain largely undefined in scientific literature. This classification status is common for numerous genes identified through large-scale sequencing projects that have yet to undergo detailed functional characterization.

Genomic Context and Expression Patterns

The genomic context of the chicken KIAA1467 homolog provides important insights into its potential biological significance. Current research in chicken genomics has revealed tissue-specific expression patterns for numerous genes, including previously uncharacterized proteins. Recent comprehensive studies cataloging highly expressed genes across eight chicken tissues have significantly advanced our understanding of tissue-specific gene expression in chickens .

Tissue Distribution Analysis

While specific expression data for KIAA1467 homolog is not directly reported in the available literature, methodologies from recent chicken tissue profiling studies could be applied to determine its expression pattern. Recent research has employed next-generation sequencing to establish repertoires of differentially overexpressed genes (DoEGs) across adult chicken tissues including testis, brain, lung, liver, kidney, muscle, heart, and intestine .

Such comprehensive tissue distribution analysis could potentially reveal whether KIAA1467 homolog belongs to the subset of tissue-specific genes or shows more ubiquitous expression patterns across chicken tissues. This type of analysis would provide valuable clues to its biological functions.

Comparative Gene Family Analysis

Recent studies analyzing chicken gene families have identified numerous uncharacterized gene families that appear to be specific to avian species. For instance, research has identified eight uncharacterized duplicated paralogs without orthologs in other metazoans except birds, making them specific to chickens/birds . Whether KIAA1467 homolog belongs to such avian-specific gene families remains to be determined.

OrganismGene SymbolSynonymsGene ID
ChickenKIAA1467 homologRCJMB04_14d19Not specified
HumanFAM234BKIAA146757613
CattleFAM234BKIAA1467512120

Available Research Products

Commercial biochemical suppliers offer various products related to KIAA1467 research. For instance, Creative BioMart provides a recombinant chicken KIAA1467 product (catalog number KIAA1467-2040C) . Such commercially available recombinant proteins serve as valuable tools for functional studies, antibody production, and other research applications.

Product TypeCatalog NumberSupplier
Recombinant Chicken KIAA1467KIAA1467-2040CCreative BioMart
Human KIAA1467 cell lysateKIAA1467-918HCLCreative BioMart

These commercial products enable researchers to conduct comparative studies between human and chicken variants of the protein, potentially revealing evolutionary conservation of structure and function.

Potential Functional Roles

While the specific functions of chicken KIAA1467 homolog remain largely unknown, several research approaches could help elucidate its biological roles. Modern genomic and proteomic strategies have proven effective in characterizing previously uncharacterized proteins across species.

Predictive Functional Analysis

Computational approaches leveraging homology with better-characterized proteins in other species represent a valuable starting point for functional prediction. Domain prediction, subcellular localization analysis, and interaction network modeling could provide initial insights into potential functions.

Relevance to Chicken Biology

Recent advances in chicken genomics highlight the importance of previously uncharacterized proteins in various biological processes. Research focused on host-microbiota interactions, for example, has revealed numerous genes involved in chicken performance and welfare . Whether KIAA1467 homolog plays a role in such processes warrants investigation.

The "HoloFood" project, which implements hologenomic analyses to understand how host genomic features and microbiota development dynamics shape animal welfare and performance, represents the type of comprehensive approach that could potentially reveal functions of proteins like KIAA1467 homolog . Such research combines multiple omics approaches, including whole-genome sequencing, metagenomics, meta-transcriptomics, and metabolomics.

Research Methodologies for Functional Characterization

Comprehensive characterization of the chicken KIAA1467 homolog would require a multi-faceted approach combining various molecular and cellular techniques. The following methodologies represent current best practices for characterizing novel proteins.

Multi-Omics Approaches

Modern multi-omics strategies offer powerful tools for protein characterization. These approaches include:

  1. Genomic analysis to identify regulatory elements and potential binding sites

  2. Transcriptomic profiling across tissues and developmental stages

  3. Proteomic analysis to identify interaction partners

  4. Metabolomic studies to identify affected metabolic pathways

Recent chicken genomics research has demonstrated the value of such integrated approaches in understanding the functions of previously uncharacterized genes .

Experimental Manipulation Strategies

Experimental approaches to determine the function of KIAA1467 homolog might include:

  1. Gene knockout or knockdown studies using CRISPR-Cas9 or RNA interference

  2. Overexpression studies to identify gain-of-function phenotypes

  3. Protein localization studies using fluorescent tagging

  4. Binding partner identification using co-immunoprecipitation or yeast two-hybrid systems

Comparative Analysis Across Species

The evolutionary conservation of KIAA1467 across species suggests functional importance. Comparative analysis between chicken KIAA1467 homolog and its counterparts in other species could provide valuable insights into conserved and species-specific functions.

Mammalian Homologs

In humans, the KIAA1467 gene (now known as FAM234B) is located on chromosome 12p13.1 . The human protein (UniProt ID: A2RU67) could serve as a reference point for functional comparison with the chicken homolog . Comparative structural and functional analyses between human and chicken variants could reveal evolutionarily conserved domains and potential functional sites.

Relevance to Poultry Science

Understanding the function of KIAA1467 homolog in chickens could have implications for poultry science, particularly if this protein plays a role in growth, development, or immune response. Chickens are not only important agricultural animals but also serve as valuable model organisms for various biological processes .

Chicken meat is one of the most commonly consumed proteins worldwide, with different cuts providing between 24 and 32 grams of protein per 100 grams . Research into chicken genomics and proteomics has significant implications for improving poultry production and welfare .

Future Research Directions

The current status of chicken KIAA1467 homolog as an uncharacterized protein presents numerous opportunities for future research. Several promising directions could significantly advance our understanding of this protein.

Comprehensive Expression Profiling

Detailed expression analysis across tissues, developmental stages, and under various physiological conditions would provide valuable insights into the biological contexts in which this protein functions. Recent studies have already established methodologies for comprehensive gene expression profiling in chicken tissues .

Functional Genomics Approaches

Application of modern functional genomics techniques, including CRISPR-based approaches for gene editing and single-cell RNA sequencing, would enable more precise characterization of KIAA1467 homolog functions. Such approaches have proven effective in elucidating the functions of previously uncharacterized proteins.

Integration with Hologenomic Studies

Incorporating KIAA1467 homolog studies into broader hologenomic research frameworks, such as those examining host-microbiota interactions, could reveal unexpected functional roles . The interaction between host genomic features and microbiota has emerged as an important factor in animal performance and welfare.

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order notes and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery information.
All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. We suggest storing working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C, while lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us and we will prioritize development of the specified tag.
Synonyms
FAM234B; KIAA1467; RCJMB04_14d19; Protein FAM234B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-623
Protein Length
full length protein
Species
Gallus gallus (Chicken)
Target Names
FAM234B
Target Protein Sequence
MATVLSRALKLPGKKSPDLGEYDPLTQADSDESEDDLVLNIQKNGGVKNGKSPPEEMQDP DSDVEVGMTKQHTSERAPEGYPAEAAGSLEQKAAPSLMPYLRTAVFLLTVVISMILVLVC AFLIPCPPRDLHNTWNHNLGQGAGGVLSPLELCDVNGDGLPDILIVFTALMNASVMGVST PSVTVVALSGMNGSTLWSIQLPEETRSVQCKGLSLGSPAEPICLVTGTAKFLSLLSASTG KTIWTLNSIHLSDGILAAPAATLPDVDGDGIRDIVVLALKETQPDVFFVLVSGKTGAALG GPVKYNVIGEGKVIGPQVHITSRGAIYILFGFGNVQAIALRDIFTQARNRDSFPMMLHQE EPEWEKRRSVNLSELIDIYSGGVDFLQTIKAPDTNCSNLLITTKEGLILLQGQDLEPRWT LEIQNISSQPVLGYFSADQTLDFMLQAQTGNGKKKVVVVDGKSGLPVWKQELPWQKQQLD ALSVMTLDKKSVFLFWADEAQPVLHSLHPGPRSERPGLHHLYLLHPVFPTVLLDLTNATD KVIASAVGINDLQKDAFHITVTTTATSEKQPGFLSVSKLGLKWAMMTQGRMVWLKDTTTP KISRGEVRRFLARLKFVDFPHKL
Uniprot No.

Target Background

Database Links

KEGG: gga:417963

UniGene: Gga.13049

Protein Families
FAM234 family
Subcellular Location
Membrane; Single-pass membrane protein. Golgi outpost. Cytoplasm, cytoskeleton, microtubule organizing center.

Q&A

What is the structural homology between chicken KIAA1467 and human FAM234B?

The chicken KIAA1467 homolog (RCJMB04_14d19) shares significant sequence similarity with human FAM234B (also known as KIAA1467). While human FAM234B is a protein-coding gene located on chromosome 12 that functions primarily as an integral component of cellular membranes, the chicken homolog likely maintains similar structural domains despite species divergence. Analysis techniques for determining homology include:

  • Multiple sequence alignment using CLUSTAL or MUSCLE algorithms

  • Phylogenetic analysis to establish evolutionary relationships

  • Domain prediction using SMART or PFAM databases

  • 3D structure prediction using homology modeling tools

Experimental verification of functional homology requires expression studies in both species using comparable tissue types, with emphasis on brain tissues where human FAM234B is predominantly expressed .

How does tissue expression of chicken KIAA1467 homolog compare to human FAM234B distribution?

Human FAM234B is primarily expressed in brain tissues and serves as an integral component of the membrane in various cell types and organs . To determine expression patterns of the chicken homolog:

Methodological approach:

  • Perform quantitative reverse transcription-polymerase chain reaction (qRT-PCR) across a panel of chicken tissues using primers specific to RCJMB04_14d19

  • Validate with Western blot analysis using antibodies that cross-react with the chicken protein

  • Conduct immunohistochemistry on tissue sections for spatial localization

  • Compare results with human expression data from databases like Human Protein Atlas

Expected findings would likely show whether the chicken homolog maintains tissue-specific expression patterns similar to the human version, particularly in neural tissues. Divergences in expression patterns may suggest species-specific functional adaptations worth further investigation .

What are the recommended controls for validating antibody specificity against chicken KIAA1467 homolog?

When validating antibodies against chicken KIAA1467 homolog for research applications, implementing rigorous controls is essential:

Validation protocol:

  • Positive controls:

    • Recombinant chicken KIAA1467 protein at known concentrations

    • Tissue lysates from regions with predicted high expression (e.g., brain tissues based on human homolog data)

  • Negative controls:

    • Tissues from chicken embryos where the gene has been knocked down via CRISPR-Cas9 or siRNA

    • Pre-absorption of antibody with recombinant protein before use

    • Secondary antibody-only controls

  • Cross-reactivity assessment:

    • Testing against known family members or structurally similar proteins

    • Testing across species using tissues from different organisms

  • Validation methods:

    • Western blotting (expected band size confirmation)

    • Immunoprecipitation followed by mass spectrometry

    • Immunohistochemistry with peptide blocking

These validation steps ensure reliable detection and localization in subsequent experiments and prevent misinterpretation of results due to non-specific binding .

What experimental designs are optimal for investigating the function of chicken KIAA1467 homolog in developmental processes?

Investigating developmental functions requires carefully designed experiments spanning multiple approaches:

Recommended experimental design:

  • Temporal expression analysis:

    • Collect embryonic tissues at various developmental stages (e.g., HH stages 5, 10, 15, 20, 25, 30, 35, 40)

    • Perform qRT-PCR and Western blot analysis for temporal profiling

    • Generate heat maps of expression changes across developmental timepoints

  • Loss-of-function studies:

    • Design CRISPR-Cas9 knockout or morpholino knockdown approaches

    • Assess phenotypic consequences across three independent replicates

    • Document developmental abnormalities with detailed imaging

    • Perform rescue experiments with wild-type protein to confirm specificity

  • Gain-of-function studies:

    • Create constructs for overexpression in chicken embryos

    • Utilize tissue-specific promoters for targeted expression

    • Compare phenotypes against controls using quantitative metrics

  • Lineage tracing:

    • Combine with fluorescent reporters to track expressing cells during development

    • Perform time-lapse imaging to capture dynamic processes

Each experiment should include at least three biological replicates and appropriate statistical analysis to ensure reproducibility and reliability of findings .

How should researchers design experiments to compare chicken KIAA1467 homolog with human FAM234B associated with neurodevelopmental disorders?

Comparative functional studies require thoughtful experimental designs that address evolutionary conservation while accounting for species-specific differences:

Cross-species experimental strategy:

  • Expression systems comparison:

    • Create expression constructs for both chicken KIAA1467 homolog and human FAM234B

    • Express in comparable neural cell lines from both species

    • Analyze subcellular localization, interacting partners, and effects on cellular morphology

  • Rescue experiments:

    • Establish knockdown/knockout systems for endogenous KIAA1467/FAM234B

    • Attempt cross-species rescue (human protein in chicken cells and vice versa)

    • Quantify rescue efficiency using appropriate functional readouts

  • Domain function analysis:

    • Generate chimeric proteins swapping domains between species

    • Assess functionality of each domain in relevant assay systems

    • Create point mutations in conserved residues to test functional importance

  • Disease-associated variant studies:

    • Introduce mutations associated with human neurodevelopmental disorders into conserved regions of chicken homolog

    • Compare functional consequences across species

    • Evaluate potential as disease modeling system

This approach allows for determination of functionally conserved regions and species-specific adaptations that may inform the evolution of protein function and disease mechanisms .

What variables must be controlled when optimizing protein expression systems for chicken KIAA1467 homolog production?

Successful recombinant protein production requires meticulous control of multiple variables:

Critical variables to control:

Variable CategorySpecific VariablesOptimization ApproachMeasurement Method
Expression VectorPromoter strengthTest multiple promotersExpression level quantification
Codon optimizationOptimize for expression systemTranslation efficiency assessment
Purification tagsTest N-terminal vs C-terminalTag interference assays
Expression SystemBacterial (E. coli)Test multiple strainsSolubility assessment
Insect cellsVarious cell linesPost-translational modifications
Mammalian cellsCHO, HEK293, etc.Functional validation
Induction ParametersTemperature16°C, 25°C, 37°CSolubility and yield comparison
Inducer concentrationTitration seriesDose-response analysis
DurationTime-course analysisOptimal harvest time determination
Purification ConditionsBuffer compositionpH, salt, additivesStability and yield assessment
Chromatography methodsMultiple methodsPurity analysis
Storage conditionsVarious temperaturesActivity retention

For membrane-associated proteins like KIAA1467 homologs, additional considerations include detergent selection for solubilization and potential reconstitution into membrane mimetics. Each variable should be systematically tested and optimized through controlled experiments with at least three replicates to ensure reproducibility .

How can researchers investigate chicken KIAA1467 homolog's potential role in pathological conditions based on human FAM234B disease associations?

Research into KIAA1467 homolog's disease relevance can be approached through translational methodologies:

Translational research strategy:

  • Disease model development:

    • Create chicken embryo models with KIAA1467 mutations corresponding to human disease variants

    • Develop cell lines with CRISPR-engineered mutations

    • Assess phenotypic consequences using quantitative metrics

  • Signaling pathway analysis:

    • Perform phosphoproteomics to identify altered signaling in mutant vs. wild-type conditions

    • Conduct RNA-seq for transcriptional changes associated with KIAA1467 dysfunction

    • Map affected pathways using bioinformatics tools like Ingenuity Pathway Analysis

  • Functional rescue experiments:

    • Test therapeutic compounds identified in human studies on chicken models

    • Evaluate gene therapy approaches using viral vectors

    • Develop screening systems for identifying novel therapeutic compounds

  • Biomarker identification:

    • Identify secreted factors or metabolic changes associated with KIAA1467 dysfunction

    • Develop detection methods applicable to clinical samples

    • Validate in multiple experimental systems

Given the association of human FAM234B with neurodevelopmental disorders and recurrent childhood high hyperdiploid acute lymphoblastic leukemia, focusing on analogous conditions in avian models would be most productive .

What approaches are recommended for analyzing protein-protein interactions of chicken KIAA1467 homolog in cellular membranes?

Membrane protein interaction studies require specialized approaches to maintain native interactions:

Interaction analysis methods:

  • Proximity-based approaches:

    • BioID or TurboID proximity labeling with KIAA1467 fusion constructs

    • APEX2 proximity labeling for temporal control

    • Split-reporter complementation assays (BiFC, SRET)

    • Analysis by mass spectrometry to identify proximal proteins

  • Co-immunoprecipitation methods:

    • Crosslinking-assisted immunoprecipitation using membrane-permeable crosslinkers

    • Digitonin or other mild detergent solubilization protocols

    • Tandem affinity purification with quantitative proteomics

    • Comparison of interactome under various cellular conditions

  • Advanced microscopy:

    • FRET/FLIM for direct interaction detection

    • Super-resolution microscopy for spatial co-localization

    • Single-molecule tracking to assess dynamic interactions

    • Correlative light and electron microscopy for ultrastructural context

  • Functional validation:

    • Mutagenesis of interaction interfaces

    • Competition assays with peptide mimetics

    • Functional readouts to assess biological relevance of interactions

Each approach has strengths and limitations, so combining multiple methods provides the most comprehensive and reliable interaction map .

What techniques are most appropriate for resolving contradictory data regarding chicken KIAA1467 homolog function across different experimental systems?

When facing contradictory results, systematic troubleshooting and reconciliation approaches are essential:

Data reconciliation strategy:

  • System-specific variation analysis:

    • Directly compare experimental conditions across studies (cell types, developmental stages, assay conditions)

    • Test protein function across multiple systems in parallel using standardized protocols

    • Quantify expression levels and protein modifications in each system

    • Create a comparative table of system-specific variables that may influence outcomes

  • Isoform and splice variant investigation:

    • Perform 5' and 3' RACE to identify all potential transcript variants

    • Specifically target each variant in functional assays

    • Quantify relative abundance of variants across tissues and conditions

    • Test functional complementation between variants

  • Post-translational modification mapping:

    • Use mass spectrometry to identify modifications across systems

    • Create modification-specific mutants (phosphomimetic, etc.)

    • Test functional consequences of each modification

    • Develop modification-specific antibodies for tracking

  • Contextual dependency experiments:

    • Systematically vary cellular context (confluence, cell cycle stage, stress conditions)

    • Test combinatorial effects with known interacting partners

    • Develop mathematical models to predict context-dependent functions

    • Validate predictions experimentally

This systematic approach can identify conditional factors that explain apparent contradictions and lead to a more nuanced understanding of protein function .

How should researchers analyze evolutionary conservation patterns of KIAA1467 homologs to predict functional domains?

Evolutionary analysis provides powerful insights into protein function through conservation patterns:

Evolutionary analysis workflow:

  • Sequence acquisition and alignment:

    • Obtain KIAA1467/FAM234B sequences from diverse species (mammals, birds, reptiles, amphibians, fish)

    • Perform multiple sequence alignment using MUSCLE or T-Coffee

    • Visualize alignments using JalView or similar tools with conservation scoring

  • Conservation analysis:

    • Calculate site-specific evolutionary rates using programs like Rate4Site

    • Identify ultra-conserved regions across distant species

    • Map conservation scores onto predicted secondary structures

    • Identify lineage-specific accelerated evolution regions

  • Functional domain prediction:

    • Correlate conservation patterns with predicted domains from Pfam/SMART

    • Identify conserved motifs using MEME or similar tools

    • Map known disease-causing mutations onto conservation patterns

    • Predict functional importance based on evolutionary constraint

  • Experimental validation:

    • Design deletion constructs based on conservation boundaries

    • Create chimeric proteins exchanging domains between distant homologs

    • Test functionality of conserved motifs through targeted mutagenesis

    • Correlate evolutionary predictions with experimental outcomes

Species GroupConservation Score (0-1)Predicted Functional Importance
Mammals0.85-0.95Critical core functions
Birds0.80-0.90Vertebrate-specific functions
Reptiles0.75-0.85Amniote-specific functions
Amphibians0.60-0.75Tetrapod-specific functions
Fish0.50-0.65Vertebrate innovations
Invertebrates0.30-0.45Ancient ancestral functions

These analyses provide a framework for prioritizing regions for detailed functional characterization .

What statistical approaches are recommended for analyzing tissue-specific expression data of chicken KIAA1467 homolog?

Robust statistical analysis of expression data requires appropriate methods for biological variation:

Statistical analysis protocol:

  • Data preprocessing:

    • Normalize qRT-PCR data using validated reference genes (GAPDH, β-actin, and 18S rRNA)

    • Apply appropriate transformations (log2) for variance stabilization

    • Perform quality control to identify and handle outliers

    • Test for normality using Shapiro-Wilk or similar tests

  • Comparative analysis:

    • For comparing expression across tissues: ANOVA with post-hoc tests (Tukey's HSD)

    • For developmental time-course: repeated measures ANOVA or mixed models

    • For comparing disease vs. normal: t-tests or non-parametric alternatives

    • Calculate fold changes with confidence intervals

  • Advanced statistical approaches:

    • Principal Component Analysis for identifying tissue-specific patterns

    • Hierarchical clustering for identifying co-regulated genes

    • Correlation analysis with phenotypic measures

    • Multiple testing correction (Benjamini-Hochberg) for genome-wide comparisons

  • Visualization techniques:

    • Heat maps for multi-tissue comparisons

    • Box plots showing distribution of expression values

    • Violin plots for comparing distributions across conditions

    • Forest plots for comparing effect sizes across experiments

Sample analysis workflow should include at least three biological replicates per condition, with appropriate adjustment for technical variation using standardized quality controls .

How can researchers distinguish between specific and non-specific effects when manipulating chicken KIAA1467 homolog expression?

Differentiating specific from non-specific effects requires carefully designed controls and validation experiments:

Specificity validation strategy:

  • Multiple targeting approaches:

    • Use different siRNA/shRNA sequences targeting distinct regions

    • Compare CRISPR-Cas9 knockout with RNAi knockdown

    • Create conditional systems (tet-inducible, etc.) to control timing

    • Compare phenotypes across all approaches for consistency

  • Rescue experiments:

    • Re-express RNAi-resistant wild-type protein

    • Create structure-function rescue panel with domain deletions

    • Use orthologous genes from distantly related species for rescue

    • Quantify rescue efficiency with dose-response analysis

  • Off-target assessment:

    • Perform RNA-seq to identify transcriptome-wide changes

    • Use non-targeting controls with similar chemical properties

    • Include scrambled sequence controls

    • Test for effects on closely related family members

  • Phenotypic specificity analysis:

    • Develop a phenotypic signature panel of multiple readouts

    • Compare to known phenotypes of related genes

    • Test epistatic relationships with interaction partners

    • Use mathematical modeling to predict specific pathway effects

How might chicken KIAA1467 homolog be involved in neurodevelopmental processes based on human FAM234B associations?

Based on human FAM234B associations with neurodevelopmental disorders, several research avenues warrant investigation:

Neurodevelopmental research approaches:

  • Neural cell fate specification:

    • Track KIAA1467 expression in neural progenitor cells during chicken embryo development

    • Manipulate expression in neural crest cells and neural tube

    • Assess effects on neuronal subtypes and glia formation

    • Quantify changes in neural differentiation markers

  • Axon guidance and synaptogenesis:

    • Visualize KIAA1467-expressing neurons during circuit formation

    • Analyze axon pathfinding in KIAA1467 knockdown models

    • Quantify synapse formation using electrophysiology and imaging

    • Test for interactions with known guidance molecules

  • Cellular membrane dynamics:

    • Investigate KIAA1467's role in neuronal migration

    • Analyze membrane protein trafficking in developing neurons

    • Examine effects on dendrite formation and arborization

    • Quantify spine morphology in mature neurons

  • Electrophysiological properties:

    • Record electrical activity in neurons with altered KIAA1467 levels

    • Measure synaptic transmission parameters

    • Analyze network formation in neuronal cultures

    • Test for seizure susceptibility in whole-embryo models

Research should focus on comparative analysis with human neurodevelopmental conditions to identify conserved mechanisms that might inform therapeutic approaches .

What methodologies are recommended for investigating potential roles of chicken KIAA1467 homolog in immune system development?

Given associations of FAM234B with lymphoblastic leukemia in humans, investigating immune system roles requires specialized approaches:

Immune system investigation methods:

  • Hematopoietic cell development:

    • Track KIAA1467 expression in developing blood lineages

    • Perform colony formation assays with manipulated expression

    • Analyze lineage commitment using flow cytometry

    • Test effects on progenitor self-renewal and differentiation

  • Immune cell function:

    • Assess impact on cytokine production and inflammatory responses

    • Measure phagocytic activity in myeloid cells

    • Analyze migration and chemotaxis

    • Test antigen presentation and T cell activation

  • Signaling pathway integration:

    • Investigate cross-talk with established immune signaling pathways

    • Analyze phosphorylation cascades in immune cells

    • Test for interactions with immune receptors

    • Map signaling networks using proteomics approaches

  • In vivo models:

    • Create chimeric embryos with KIAA1467-modified hematopoietic cells

    • Challenge with immune stimulants to assess functional consequences

    • Analyze thymic and bursal development in manipulated embryos

    • Track long-term lineage development using barcoding approaches

This systematic approach will determine whether KIAA1467's association with leukemia reflects a fundamental role in immune development or a pathological mechanism specific to disease states .

How can researchers develop translational applications of chicken KIAA1467 homolog research for human disease understanding?

Translating findings from chicken models to human disease applications requires strategic approaches:

Translational research framework:

  • Comparative disease modeling:

    • Identify human conditions with KIAA1467/FAM234B involvement

    • Create parallel chicken models with equivalent genetic modifications

    • Compare phenotypes across species at cellular and physiological levels

    • Validate molecular mechanisms across species

  • Drug screening and development:

    • Establish cell-based assays suitable for high-throughput screening

    • Screen compound libraries for modulators of KIAA1467 function

    • Validate hits in increasingly complex systems (cells → embryos → animal models)

    • Test successful candidates in human cell models

  • Biomarker development:

    • Identify conserved downstream effectors altered in disease states

    • Develop detection methods applicable to clinical samples

    • Validate in multiple experimental systems and species

    • Test correlation with disease progression and treatment response

  • Gene therapy approaches:

    • Develop viral vectors for correcting KIAA1467 dysfunction

    • Test delivery methods in chicken embryo models

    • Assess long-term expression and functional correction

    • Translate successful approaches to mammalian models

This coordinated approach leverages the accessibility and manipulability of the chicken model while maintaining focus on human health applications .

What are the most critical knowledge gaps in understanding chicken KIAA1467 homolog function that researchers should prioritize?

Current research reveals several critical knowledge gaps that warrant prioritization:

  • Basic structural and biochemical characterization of the chicken KIAA1467 homolog protein

  • Comparative analysis of tissue expression patterns between chicken and mammalian homologs

  • Identification of protein interaction partners specific to avian systems

  • Determination of subcellular localization and trafficking mechanisms

  • Elucidation of developmental roles in neural and immune system development

Researchers should initially focus on establishing fundamental characteristics before proceeding to more complex functional studies. Collaborative approaches combining structural biology, developmental biology, and systems-level analyses will be most effective in addressing these knowledge gaps comprehensively .

What standardized protocols should be developed to ensure reproducibility in chicken KIAA1467 homolog research?

To enhance reproducibility and facilitate cross-laboratory validation, these standardized protocols are recommended:

  • Protein expression and purification protocol with detailed buffer compositions and quality control metrics

  • Validated antibody characterization and immunodetection procedures

  • Standardized embryonic manipulation techniques with precise staging criteria

  • Cell culture systems optimized for KIAA1467 functional studies

  • Data reporting templates that include all relevant experimental parameters

Each protocol should specify minimum requirements for biological replicates, positive and negative controls, validation criteria, and statistical approaches. These standards will accelerate research progress by allowing direct comparison of results across different research groups .

How should multidisciplinary approaches be integrated to comprehensively understand chicken KIAA1467 homolog biology?

Effective integration of diverse scientific disciplines requires coordinated approaches:

  • Establish research consortia with expertise spanning structural biology, developmental biology, immunology, and neuroscience

  • Develop shared resources including antibodies, expression constructs, and animal models

  • Create common bioinformatic pipelines for data analysis and integration

  • Implement regular data sharing and collaborative experimental design

This multidisciplinary framework ensures comprehensive characterization from molecular mechanisms to organismal functions, maximizing research efficiency and accelerating discovery .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.