Recombinant Chicken UPF0414 transmembrane protein C20orf30 homolog (RCJMB04_6c24)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
TMEM230; RCJMB04_6c24; Transmembrane protein 230
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Gallus gallus (Chicken)
Target Names
TMEM230
Target Protein Sequence
MMPSRTNLSAGIPSSKVKYSKLASTDDGYIDLQFKKSPPKIPYKAIALAVVLFMIGTFLI IIGALLLAGYISKGGTDRAIPVLIIGILVFLPGFYHLRIAYYASKGYRGYSYDDIPDFDD
Uniprot No.

Target Background

Function
This protein is involved in the trafficking and recycling of synaptic vesicles.
Database Links
Protein Families
TMEM134/TMEM230 family
Subcellular Location
Membrane; Multi-pass membrane protein. Golgi apparatus, trans-Golgi network. Cytoplasmic vesicle, secretory vesicle, synaptic vesicle. Early endosome. Recycling endosome. Late endosome. Cytoplasmic vesicle, autophagosome.

Q&A

What is the function of UPF0414 transmembrane protein C20orf30 homolog in chickens?

The UPF0414 transmembrane protein C20orf30 homolog in chickens is primarily involved in trafficking and recycling of synaptic vesicles, similar to its human counterpart TMEM230 . This protein belongs to the uncharacterized protein family (UPF) 0414, containing multiple transmembrane domains conserved across species. Functional studies indicate its role in vesicular transport systems within neuronal cells.

To experimentally confirm this function, researchers should employ:

  • Co-immunoprecipitation with known vesicle trafficking proteins

  • Subcellular fractionation studies to isolate synaptic vesicle populations

  • Fluorescent tagging for live-cell imaging of protein trafficking

  • Knockout/knockdown studies to assess phenotypic effects on vesicle dynamics

What expression patterns have been observed for UPF0414 transmembrane protein in avian tissues?

While specific expression data for chicken UPF0414 is limited in the available literature, inference from mammalian studies suggests predominant expression in neural tissues with potential secondary expression in secretory organs. This protein likely demonstrates developmental regulation, with expression patterns changing throughout embryonic development.

To determine tissue-specific expression profiles, researchers should consider:

  • RT-qPCR analysis across multiple tissue types

  • In situ hybridization in embryonic and adult chicken tissues

  • Immunohistochemistry with validated antibodies

  • Single-cell RNA sequencing of neural tissues to identify cell-type specificity

Each approach requires careful experimental design following randomized complete block design principles to ensure statistical validity .

What expression systems are optimal for producing functional Recombinant Chicken UPF0414 transmembrane protein?

The selection of an appropriate expression system is critical for obtaining functional recombinant transmembrane proteins. While E. coli systems are commonly used for cytosolic proteins , transmembrane proteins typically require eukaryotic expression systems for proper folding and post-translational modifications.

Expression SystemAdvantagesLimitationsOptimal Conditions
E. coliHigh yield, low costLimited PTMs, inclusion bodies commonFusion tags (MBP, SUMO), low temperature induction
Insect cells (Sf9)Proper folding, moderate PTMsModerate cost, complex media27°C, 72-96h expression period
Mammalian (HEK293)Native-like folding, complete PTMsHigher cost, lower yield37°C, 5% CO₂, transient or stable expression
Cell-free systemsRapid, membrane mimetics possibleLimited scale, expensiveSupplementation with detergents or liposomes

For UPF0414 transmembrane protein, insect cell or mammalian expression systems are recommended, with constructs incorporating N-terminal or C-terminal affinity tags positioned to avoid interfering with transmembrane domains .

How can recombinant UPF0414 transmembrane protein be effectively used as a control in Western blot and immunohistochemistry experiments?

Recombinant UPF0414 transmembrane protein serves as an essential control for antibody validation in multiple applications. Based on experimental protocols for similar proteins, the recommended approach includes:

  • For blocking experiments: Use a 100x molar excess of recombinant protein relative to the primary antibody concentration

  • Pre-incubate the antibody-protein control mixture for 30 min at room temperature before application

  • In Western blots: Run the recombinant protein alongside tissue lysates as a positive control

  • For quantitative applications: Create a standard curve with known concentrations

Storage recommendations include maintaining the protein at -20°C for regular use and -80°C for extended storage, while avoiding repeated freeze-thaw cycles. Working aliquots can be stored at 4°C for up to one week .

What are the optimal purification strategies for UPF0414 transmembrane proteins?

Purification of transmembrane proteins presents unique challenges due to their hydrophobic nature. For UPF0414 transmembrane proteins, a systematic approach is required:

  • Membrane isolation: Differential centrifugation to separate cellular membranes

  • Solubilization: Screen detergents (DDM, CHAPS, Triton X-100) at various concentrations

  • Affinity chromatography: Utilize His-tag or other fusion tags for initial capture

  • Size exclusion chromatography: Remove aggregates and achieve higher purity

Buffer optimization should include screening different pH conditions (typically pH 7-8) and salt concentrations (150-300 mM NaCl). Adding glycerol (10-20%) helps stabilize the protein during purification, as demonstrated in storage buffers for similar proteins .

For challenging cases, consider nanodiscs or styrene maleic acid copolymer (SMA) approaches that maintain the native lipid environment. Each purification step should be monitored for yield and activity.

What experimental approaches are most effective for studying UPF0414 protein localization in chicken neural tissues?

For studying protein localization in chicken neural tissues, multiple complementary approaches should be employed:

  • Immunohistochemistry with confocal microscopy provides high-resolution spatial information. When using recombinant proteins as controls, it's essential to validate antibody specificity through blocking experiments .

  • For subcellular localization, electron microscopy with immunogold labeling offers nanometer-scale resolution necessary for membrane compartment identification.

  • For live-cell studies, expressing fluorescently-tagged versions of the protein allows for real-time trafficking analysis using techniques such as:

    • FRAP (Fluorescence Recovery After Photobleaching)

    • FLIP (Fluorescence Loss In Photobleaching)

    • Single-particle tracking

  • Co-localization studies with markers for different subcellular compartments (endosomes, Golgi, synaptic vesicles) provide functional insights.

Experimental design should follow randomized complete block design principles with appropriate technical and biological replicates to ensure statistical validity .

How should researchers design experiments to study the role of UPF0414 transmembrane protein in vesicle trafficking?

Investigating vesicle trafficking functions requires specialized experimental designs. Based on knowledge of similar proteins , a multi-faceted approach is recommended:

  • Live-cell imaging approaches:

    • TIRF microscopy for events at the plasma membrane

    • Spinning disk confocal for rapid 3D acquisition

    • Dual-color imaging of UPF0414 with vesicle markers

  • Functional assays measuring:

    • Exocytosis/endocytosis rates

    • Recycling kinetics

    • Vesicle fusion events

  • Genetic manipulation strategies:

    • CRISPR-Cas9 knockout models

    • Dominant-negative mutants

    • Structure-function analysis with domain deletions

Experimental design should utilize factorial approaches to test multiple variables simultaneously, with the design.ab function in R's agricolae package suitable for generating experimental plans . Statistical analysis should include appropriate tests for time-series data, such as repeated measures ANOVA.

How can computational approaches predict function and interactions of UPF0414 transmembrane protein?

Computational approaches provide valuable insights when experimental data is limited. For UPF0414 transmembrane protein, a hierarchical strategy is recommended:

  • Sequence-based analysis:

    • BLAST/PSI-BLAST for identifying functional homologs

    • Multiple sequence alignment to identify conserved residues

    • Motif scanning for known functional domains

  • Structural prediction:

    • Transmembrane topology prediction (TMHMM, Phobius)

    • 3D structure modeling using coarse-grained approaches

    • Molecular dynamics simulations in membrane environments

  • Interaction prediction:

    • Protein-protein interaction databases mining

    • Molecular docking with potential binding partners

    • Co-evolution analysis to identify interacting residues

For transmembrane protein modeling, Monte Carlo simulations using patchy particle models have proven effective for predicting self-assembly and interaction patterns . These computational predictions generate testable hypotheses that should guide subsequent experimental design.

What are common challenges in working with UPF0414 transmembrane proteins and how can they be addressed?

Working with transmembrane proteins presents several technical challenges:

ChallengeCauseSolution
Low expression yieldToxicity to host cells, protein misfoldingUse inducible systems, lower temperature, fusion with solubility tags
Protein aggregationHydrophobic interactions, improper foldingScreen detergents, add stabilizers (glycerol, specific lipids)
Poor antibody specificityLimited accessible epitopesGenerate antibodies against extracellular/cytoplasmic domains, use blocking controls
Inconsistent purificationVariable solubilizationStandardize membrane:detergent ratios, use internal standards
Function loss during purificationRemoval from native lipid environmentConsider membrane mimetics (nanodiscs, liposomes)

For storage stability, maintain the protein in Tris-based buffer with 50% glycerol at -20°C for short-term or -80°C for extended storage . Avoid repeated freeze-thaw cycles by preparing single-use aliquots.

What statistical approaches are appropriate for analyzing quantitative data from UPF0414 protein expression studies?

For quantitative analysis of UPF0414 protein expression data, the experimental design determines the appropriate statistical approach:

  • For comparing expression across conditions:

    • Randomized complete block design (RCBD) controls for batch effects

    • ANOVA followed by post-hoc tests (Tukey's HSD) for multiple comparisons

    • Non-parametric alternatives (Kruskal-Wallis, Mann-Whitney) for non-normal data

  • For factorial experiments:

    • The design.ab function in R's agricolae package generates appropriate experimental plans

    • Two-way or multi-way ANOVA for interaction effects

    • Mixed models for repeated measures or nested designs

  • For regression analysis:

    • Linear models for continuous predictors

    • Generalized linear models for non-normal distributions

    • Principal component analysis for multivariate data reduction

Power analysis should be conducted before experimentation to ensure sufficient sample sizes for detecting biologically meaningful differences with statistical significance.

How can researchers validate antibodies against Chicken UPF0414 transmembrane protein?

Antibody validation is critical for ensuring experimental reproducibility. For UPF0414 transmembrane protein, a systematic validation approach includes:

  • Western blot validation:

    • Confirm band at expected molecular weight

    • Verify signal reduction after protein knockdown

    • Compare results with multiple antibodies targeting different epitopes

    • Use blocking peptide controls (100x molar excess)

  • Immunohistochemistry validation:

    • Compare staining patterns with mRNA expression data

    • Perform peptide competition assays

    • Include knockout/knockdown samples as negative controls

  • Cross-reactivity testing:

    • Test against homologous proteins (e.g., UPF0414 from other species)

    • Assess binding to synthetic peptide arrays

    • Evaluate specificity across tissue panels

Quantitative metrics should be established for each validation step, with clear acceptance criteria defined before experimental application.

What emerging technologies show promise for studying UPF0414 transmembrane proteins?

Recent technological advances offer new opportunities for transmembrane protein research:

  • Cryo-electron microscopy:

    • Near-atomic resolution of membrane proteins in native-like environments

    • Sample preparation without crystallization

    • Visualization of dynamic conformational states

  • Proximity labeling methods:

    • BioID or TurboID fusion proteins to identify proximal interactors

    • APEX2 for electron microscopy-compatible labeling

    • Split-BioID for studying conditional interactions

  • Optogenetic approaches:

    • Light-controlled activation/inactivation of protein function

    • Real-time manipulation in living systems

    • Cell-specific targeting in complex tissues

  • Advanced imaging:

    • Super-resolution microscopy (STORM, PALM)

    • Expansion microscopy for improved resolution

    • Correlative light and electron microscopy (CLEM)

These technologies should be integrated with computational approaches and traditional biochemical methods for comprehensive characterization of UPF0414 transmembrane protein function.

How does UPF0414 transmembrane protein function in disease models and therapeutic development?

While specific disease associations for chicken UPF0414 are not well characterized, research on mammalian orthologs provides direction for future studies:

  • Neurological disease models:

    • Given its role in vesicle trafficking, examine function in neurodegenerative conditions

    • Investigate potential role in synaptic plasticity disorders

    • Study in avian models of neurological development

  • Comparative biology approaches:

    • Leverage evolutionary conservation to understand functional importance

    • Identify species-specific adaptations in avian systems

    • Use cross-species complementation to assess functional conservation

  • Therapeutic targeting strategies:

    • Explore small molecule modulators of trafficking function

    • Assess antibody-based targeting of extracellular domains

    • Consider gene therapy approaches for modulating expression

Experimental designs should incorporate appropriate controls and utilize randomized complete block design principles with adequate replication to ensure robust, reproducible results .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.