Recombinant Chicken UPF0444 transmembrane protein C12orf23 homolog (RCJMB04_6o13)

Shipped with Ice Packs
In Stock

Description

Nomenclature and Alternative Designations

The protein is known by several names in scientific literature and commercial databases. The primary designation is "UPF0444 transmembrane protein C12orf23 homolog," but it is also referred to as transmembrane protein 263 (TMEM263) . This diversity in nomenclature reflects the evolutionary conservation of this protein across species while acknowledging its initial identification through human genome mapping projects. The gene encoding this protein has been annotated with multiple designations including TMEM263, C12orf23, and C1H12ORF23 in chicken genomic databases .

Protein Structure and Domains

While detailed structural information specifically for the chicken variant is limited, orthologous TMEM263 proteins typically feature membrane-spanning domains characteristic of transmembrane proteins. These proteins generally contain hydrophobic regions that anchor them within the cell membrane, with both intracellular and extracellular components that potentially participate in signaling pathways or transport functions. The recombinant versions available commercially are often partial sequences, focusing on the functional domains of interest rather than the complete protein .

Expression Systems

The recombinant protein is produced using various host systems, including bacterial (E. coli), yeast, baculovirus, and mammalian cell expression platforms . Each system offers specific advantages in terms of protein folding, post-translational modifications, and yield. The choice of expression system can significantly impact the structural and functional properties of the recombinant protein, particularly for transmembrane proteins that require specific membrane environments for proper folding.

Physical and Biochemical Properties

Understanding the physical and biochemical properties of the recombinant chicken UPF0444 transmembrane protein is essential for its proper handling and application in research settings.

Protein Characteristics

The recombinant protein is typically produced with high purity standards, ranging from >85% to >90% as determined by SDS-PAGE analysis . Depending on the supplier and specific preparation, the protein may be tagged for purification and detection purposes, though the tag type is generally determined during the manufacturing process rather than being standardized across suppliers . The partial recombinant protein retains the key structural features necessary for functional studies while potentially omitting regions that might compromise stability or solubility.

Reconstitution Guidelines

For lyophilized preparations, proper reconstitution is essential for maintaining protein activity. Suppliers recommend:

  1. Brief centrifugation of the vial before opening to collect contents at the bottom

  2. Reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  3. Addition of glycerol to a final concentration of 5-50% for preparations intended for long-term storage

This careful reconstitution process helps ensure the structural integrity and functional activity of the transmembrane protein, which can be particularly sensitive to handling conditions.

Functional Significance and Biological Role

While the specific function of UPF0444 transmembrane protein C12orf23 homolog in chickens remains incompletely characterized, research on orthologous genes provides insights into its potential biological roles.

Association with Growth and Development

Evidence suggests that TMEM263, the gene encoding this transmembrane protein, plays a significant role in growth and developmental processes. A study identified a nonsense mutation in the TMEM263 gene completely associated with autosomal dwarfism (adw) in chickens . This mutation truncates the transmembrane protein within the membrane-spanning domain, likely resulting in a dysfunctional protein that alters body growth and development . This finding establishes a potential link between this protein and growth regulation pathways in avian species.

Bone Mineral Deposition

Research indicates that TMEM263 is associated with bone mineral deposition in humans, suggesting a conserved role in skeletal development across vertebrate species . This function may be particularly relevant in poultry research, where bone development and integrity are critical factors in production and welfare considerations. The mechanism by which this transmembrane protein influences bone mineralization remains unclear but represents an important area for future investigation.

Protein Interactions

Interestingly, TMEM263 shows interaction with growth hormone 1 (GH1), providing a potential molecular mechanism for its involvement in growth regulation . This interaction may mediate signaling pathways that control cellular growth, differentiation, and metabolism. In the context of the chicken model, this interaction could explain the link between TMEM263 mutations and the dwarf phenotype, as growth hormone signaling is a central regulator of body size and proportion.

Research Applications and Immunological Context

The recombinant chicken UPF0444 transmembrane protein has potential applications in various research contexts, particularly in studies of avian development, comparative genomics, and immunology.

Developmental Biology Research

The association between TMEM263 mutations and dwarfism in chickens makes this protein valuable for research in developmental biology, particularly studies focused on growth regulation and skeletal development . The availability of recombinant forms enables in vitro studies to characterize the molecular mechanisms underlying these developmental processes.

Comparative Immunology Applications

In the context of avian immunology, recombinant proteins like UPF0444 transmembrane protein can serve as important tools for understanding species-specific immune responses. Chickens express antibodies with a classical H2L2 structure, but with unique diversification mechanisms involving gene conversion from pseudogenes . Transgenic chickens expressing antibodies from immunoglobulin loci containing human variable regions and chicken constant regions have been developed, highlighting the importance of chicken models in comparative immunology .

Potential in Functional Analysis Studies

The protein may also have applications in functional analysis patterns research, where varying patterns of functional analysis differentiation can predict treatment outcomes . While not directly related to UPF0444 transmembrane protein, the methodologies of functional analysis could be applied to better understand the role of this protein in different physiological contexts.

Limitations and Future Research Directions

Despite commercial availability and growing understanding of its functions, significant knowledge gaps remain regarding the UPF0444 transmembrane protein C12orf23 homolog in chickens.

Current Limitations

The protein is primarily characterized through homology with human and other vertebrate orthologs rather than through direct functional studies in chickens . Most commercial preparations offer partial protein sequences, potentially limiting studies that require the full-length protein with all functional domains intact . Additionally, the lack of detailed structural information restricts our understanding of the protein's mechanism of action.

Future Research Priorities

Future research should focus on:

  1. Comprehensive structural characterization of the chicken UPF0444 transmembrane protein

  2. Detailed mapping of protein interaction networks, particularly with growth hormone signaling components

  3. Functional studies using knockout or knockdown approaches in avian cell lines

  4. Comparative analysis across different avian species to understand evolutionary conservation and divergence

Such investigations would significantly enhance our understanding of this protein's role in avian biology and potentially reveal novel applications in biotechnology or veterinary medicine.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will prepare the product according to your specifications.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery information.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid formulations is 6 months at -20°C/-80°C. The shelf life of lyophilized formulations is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
TMEM263; RCJMB04_6o13; Transmembrane protein 263
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-116
Protein Length
full length protein
Species
Gallus gallus (Chicken)
Target Names
TMEM263
Target Protein Sequence
MNQTDKSHQEVPSYLHDEPPEGSIKDHPQQQPSMLSRVTGGIFSVTKGAVGATIGGVAWI GGKSLEITKTAVTSVPSMGVGLVKGSVSAVAGGVTAVGSAVASKVPLTGKKKDKSD
Uniprot No.

Target Background

Database Links
Protein Families
TMEM263 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the Recombinant Chicken UPF0444 transmembrane protein C12orf23 homolog?

The Recombinant Chicken UPF0444 transmembrane protein C12orf23 homolog (RCJMB04_6o13) is a transmembrane protein in chickens. This protein, also referred to as TMEM263, is associated with growth and bone development pathways. Research indicates that TMEM263 (former alias: C12orf23) is functionally involved in skeletal development, potentially through mechanisms affecting cartilage and bone formation . The recombinant form refers to the protein produced through genetic engineering techniques for research purposes.

What are the known functions of TMEM263 in chickens?

Based on current research, TMEM263 appears to have several important functions in chickens:

  • Growth regulation: Evidence suggests that TMEM263 interacts with growth hormone 1 (GH1), potentially acting as a regulator in transport or signal transduction within growth pathways .

  • Skeletal development: Studies have shown correlations between TMEM263 expression and bone development, particularly in relation to bone mineral density .

  • Neurological functions: Research has identified TMEM263 as an interaction partner of potassium channel genes Slick and Slack, which are sodium-activated channels widely expressed in the central nervous system .

Loss-of-function mutations in TMEM263 have been associated with autosomal dwarfism in chickens, characterized by approximately 30% growth reduction with short shanks .

How is TMEM263 expressed in different chicken tissues?

While specific tissue expression profiles are not detailed in the available research results, studies indicate that TMEM263 expression levels correlate with bone mineral density and osteoporotic fracture risk . The protein appears to be functionally involved in cartilage and bone formation, suggesting significant expression in skeletal tissues. Additionally, its interaction with potassium channel genes expressed in the central nervous system suggests potential expression in neural tissues . Researchers investigating tissue-specific expression should employ RT-PCR or RNA-seq methodologies to quantify expression across different tissue types.

What methodologies are recommended for studying TMEM263 protein-protein interactions?

To effectively study TMEM263 protein-protein interactions, researchers should consider the following methodological approaches:

  • Co-immunoprecipitation followed by mass spectrometry: This approach has previously been successful in identifying interactions between TMEM263 and growth hormone 1 (GH1) . Researchers should use flag-tagged recombinant TMEM263 expressed in chicken cell lines, followed by pull-down assays and mass spectrometry analysis to identify binding partners.

  • Yeast two-hybrid screening: This system can identify potential interaction partners from a chicken cDNA library, providing insights into the protein's functional networks.

  • Bimolecular Fluorescence Complementation (BiFC): This technique can visualize protein interactions in living cells, offering spatial and temporal information about TMEM263 interactions.

  • Proximity Labeling techniques: Methods such as BioID or APEX can identify proteins in close proximity to TMEM263 within cellular compartments.

When analyzing results, researchers should validate interactions using multiple methods and consider the biological context of interactions, particularly in relation to growth pathways and bone development.

How can loss-of-function mutations in TMEM263 be generated for functional studies?

Several approaches can be implemented to generate loss-of-function mutations in TMEM263 for functional studies:

  • CRISPR-Cas9 gene editing: Design guide RNAs targeting specific regions of the TMEM263 gene, followed by transfection into chicken embryonic fibroblasts or direct injection into embryos. The nonsense mutation identified in previous research (p.Trp59*) provides a specific target site .

  • RCAS viral vector system: Following the protocol described in search result , researchers can use RCASBP(A) vectors to deliver modified TMEM263 constructs. This approach has been successfully used for transgenic chicken creation:

    • Clone the TMEM263 sequence (with introduced mutations) between restriction sites in RCASBP(A) vectors

    • Rescue recombinant viruses using chicken embryo fibroblasts (DF-1)

    • Confirm expression by immunofluorescence staining

    • Inoculate 2-day-old embryonated eggs with infected DF1 cells

  • RNA interference (RNAi): Design siRNAs or shRNAs targeting TMEM263 mRNA for transient or stable knockdown experiments.

  • Morpholino antisense oligonucleotides: For developmental studies, inject morpholinos targeting TMEM263 mRNA into early-stage chicken embryos.

Each approach has specific advantages depending on the research question, with CRISPR-Cas9 offering precision for permanent genomic modifications, while RNAi provides flexibility for temporal studies.

What are the current hypotheses regarding TMEM263's role in bone development pathways?

Current research suggests several hypotheses regarding TMEM263's role in bone development:

  • Osteoblast functional module regulation: Expression studies have shown TMEM263 is significantly correlated with osteoblast functional modules (OFMs), which impact bone mineral density by altering the activity of bone-forming osteoblasts .

  • Growth hormone signaling pathway integration: The physical interaction between TMEM263 and growth hormone 1 suggests potential involvement in growth hormone signaling cascades that regulate bone growth and development .

  • Mineral deposition regulation: The association with femoral neck bone mineral density (FN-BMD) suggests TMEM263 may influence the deposition of bone mineral, thereby affecting skeletal development .

  • Cartilage formation mediation: The growth deficiency and short shank phenotype observed in autosomal dwarf chickens with TMEM263 mutations suggest potential roles in cartilage formation during developmental stages .

To test these hypotheses, researchers should implement both in vitro studies using chicken osteoblast cultures and in vivo models with TMEM263 modifications, measuring outcomes through bone mineral density assays, growth measurements, and histological analyses of bone and cartilage development.

How should researchers design experiments to study TMEM263 function in chicken embryonic development?

When designing experiments to study TMEM263 function in chicken embryonic development, researchers should follow these methodological steps:

  • Define clear variables and hypotheses:

    • Independent variable: TMEM263 expression levels or mutations

    • Dependent variables: Growth measurements, skeletal development markers, bone mineral density

    • Control for confounding variables such as genetic background and environmental conditions

  • Generate appropriate experimental models:

    • Use the RCAS viral vector system to create transgenic chickens expressing modified TMEM263

    • Implement CRISPR-Cas9 to generate embryos with specific TMEM263 mutations

    • Consider both gain-of-function and loss-of-function approaches

  • Implement a comprehensive measurement protocol:

    • Temporal tracking of embryonic development at key developmental stages

    • Morphometric measurements of skeletal elements

    • Histological analysis of bone and cartilage formation

    • Molecular analysis of downstream signaling pathways

  • Statistical design considerations:

    • Determine appropriate sample sizes through power analysis

    • Implement randomization procedures to minimize bias

    • Use statistical methods suitable for developmental data, such as repeated measures ANOVA for growth trajectories

  • Validation through rescue experiments:

    • In TMEM263-knockout models, reintroduce wild-type TMEM263 to confirm phenotype rescue

    • Test structure-function relationships using various TMEM263 mutant constructs

This systematic approach ensures robust data collection while controlling for extraneous variables that might influence developmental outcomes .

What control measures should be implemented when studying recombinant TMEM263 in chicken cell culture systems?

When studying recombinant TMEM263 in chicken cell culture systems, implement the following control measures to ensure experimental validity:

  • Expression controls:

    • Empty vector controls to account for vector-related effects

    • Wild-type TMEM263 expression alongside mutant constructs

    • Quantitative verification of protein expression levels via Western blot

    • Flag-tagged or fluorescently labeled constructs to monitor localization

  • Cell line considerations:

    • Use of appropriate chicken cell lines (e.g., DF-1 chicken embryo fibroblasts)

    • Matched passage numbers between experimental and control groups

    • Testing in multiple cell types to avoid cell-type-specific artifacts

  • Functional controls:

    • Positive controls using known modulators of bone development pathways

    • Negative controls with non-targeting constructs

    • Dose-response experiments to establish expression-effect relationships

  • Experimental validation:

    • Independent replication of key findings

    • Alternative methodological approaches to confirm results

    • Rescue experiments to verify specificity of observed phenotypes

  • Quality control for recombinant protein:

    • Verification of protein integrity through SDS-PAGE

    • Confirmation of proper folding through functional assays

    • Testing for endotoxin contamination that could affect cellular responses

Following these control measures will minimize experimental artifacts and increase confidence in results related to TMEM263 function in cell culture systems.

How should researchers interpret phenotypic data from TMEM263 knockout chickens?

When interpreting phenotypic data from TMEM263 knockout chickens, researchers should implement the following methodological approach:

  • Comprehensive phenotyping protocol:

    • Growth measurements: Track weight, height, and limb measurements at standardized intervals

    • Skeletal assessment: Perform radiographic analysis, micro-CT scans, and histological examination

    • Physiological parameters: Evaluate metabolic markers, hormonal profiles, and tissue-specific gene expression

  • Statistical analysis framework:

    • Compare knockout phenotypes to both wild-type and heterozygous controls

    • Apply appropriate statistical tests based on data distribution (parametric or non-parametric)

    • Implement mixed effects models for longitudinal data to account for individual variation

  • Interpret data in context of known TMEM263 functions:

    • Expected phenotype based on previous research includes approximately 30% growth reduction with short shanks

    • Compare observed phenotypes with those reported for autosomal dwarfism (adw) in the Cornell K-strain White Leghorns

    • Analyze bone mineral density measurements in relation to TMEM263's association with osteoblast functional modules

  • Establish causality through:

    • Rescue experiments reintroducing functional TMEM263

    • Domain-specific mutations to identify critical functional regions

    • Molecular pathway analysis to connect genotype to phenotype

  • Address variability and potential compensatory mechanisms:

    • Evaluate potential upregulation of functionally related genes

    • Consider developmental timing of knockout effects

    • Assess tissue-specific consequences of TMEM263 ablation

This structured approach ensures thorough interpretation while acknowledging the complex nature of developmental phenotypes in vertebrate models.

What analytical methods are recommended for studying TMEM263 expression correlation with bone mineral density?

To effectively analyze TMEM263 expression correlation with bone mineral density (BMD), researchers should implement these methodological approaches:

  • Correlation analysis framework:

    • Quantify TMEM263 expression using RT-qPCR or RNA-seq in relevant tissues

    • Measure BMD using dual-energy X-ray absorptiometry (DEXA) or micro-computed tomography (μCT)

    • Calculate correlation coefficients (Pearson's or Spearman's) between expression levels and BMD measurements

    • Implement multiple regression models to control for confounding variables like age, sex, and body weight

  • Experimental design considerations:

    • Use age-matched cohorts to control for developmental variation

    • Include sufficient sample sizes (determined by power analysis)

    • Consider both homozygous and heterozygous TMEM263 variant carriers

  • Advanced statistical methods:

    • Mediation analysis to determine if TMEM263 effects on BMD are direct or mediated through other pathways

    • Structural equation modeling to test complex relationships between variables

    • Longitudinal data analysis to track expression-BMD relationships over time

  • Data visualization approaches:

    • Scatter plots with regression lines to illustrate correlations

    • Heat maps showing expression patterns across tissues in relation to BMD

    • Forest plots for meta-analysis of multiple experiments

Statistical TestApplicationAdvantagesLimitations
Pearson's correlationLinear relationships between TMEM263 expression and BMDSimple interpretation, quantifies strength and directionAssumes normal distribution, only detects linear relationships
Spearman's rank correlationMonotonic relationships, regardless of linearityRobust to outliers, no normality assumptionLess statistical power than Pearson's
Multiple regressionControl for confounding variablesModels complex relationships with multiple predictorsRequires larger sample sizes, assumes independence of observations
Mixed effects modelsLongitudinal BMD measurementsAccounts for within-subject correlationComputational complexity, requires specialized software

This analytical framework provides robust methods to establish and characterize the relationship between TMEM263 expression and bone mineral density reported in previous studies .

How can TMEM263 research inform understanding of bone development disorders in other species?

Research on chicken TMEM263 provides valuable insights into bone development disorders across species through the following mechanisms:

  • Comparative genomic approaches:

    • TMEM263 is evolutionarily conserved, with homologs in mammals including humans

    • Findings from chicken models can be translated to understand human conditions like osteoporosis and growth deficiencies

    • Research shows TMEM263 is associated with femoral neck bone mineral density in humans, similar to its role in chicken skeletal development

  • Translational research methodology:

    • Identify conserved functional domains between chicken and human TMEM263

    • Compare expression patterns across species in skeletal tissues

    • Develop cross-species experimental models to test functional conservation

  • Applications to human disorders:

    • TMEM263 variants could potentially contribute to human short stature syndromes

    • The protein's association with osteoblast functional modules suggests relevance to human bone mineral density regulation

    • Research on TMEM263-mediated growth hormone interactions may inform treatment approaches for growth disorders

  • Veterinary applications:

    • Understanding TMEM263 function could improve breeding strategies for livestock

    • Potential therapeutic applications for bone development disorders in companion animals

    • Diagnostic markers for skeletal growth abnormalities in multiple species

Future research should implement comparative functional studies between chicken and mammalian TMEM263 to fully leverage the translational potential of this research area.

What are the most promising research directions for understanding TMEM263 interaction with viral defense mechanisms?

While current research primarily focuses on TMEM263's role in growth and bone development, its potential intersection with viral defense mechanisms represents an emerging research direction:

  • Protein family relationships:

    • TMEM263 is a transmembrane protein, and other transmembrane proteins like the IFITM family play crucial roles in viral defense

    • Research shows chIFITM proteins can inhibit influenza virus replication and may serve as barriers against zoonotic infections

    • Investigation into functional relationships between TMEM263 and antiviral transmembrane proteins is warranted

  • Methodological approaches for viral interaction studies:

    • Co-expression studies of TMEM263 with viral restriction factors

    • Viral challenge experiments in cells with modified TMEM263 expression

    • Proteomics approaches to identify TMEM263 interactions during viral infection

    • RCAS viral vector systems used in TMEM263 studies can also be applied to investigate viral mechanisms

  • Research questions to explore:

    • Does TMEM263 expression change during viral infection?

    • Can TMEM263 modulate membrane fusion events critical for viral entry?

    • Are there interactions between TMEM263 and known viral restriction factors?

    • Does TMEM263 localize to cellular compartments relevant to viral replication?

  • Experimental design considerations:

    • Use transgenic approaches established for TMEM263 research to study viral susceptibility

    • Implement challenge studies with zoonotic viruses in transgenic chickens

    • Apply techniques from both fields to bridge the knowledge gap

This research direction could potentially uncover novel functions of TMEM263 beyond its established role in growth and bone development.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.