Recombinant Chicken UPF0694 transmembrane protein C14orf109 homolog (RCJMB04_5b13)

What is the structural characterization of UPF0694 transmembrane protein C14orf109 homolog (RCJMB04_5b13)?

The UPF0694 transmembrane protein C14orf109 homolog (RCJMB04_5b13) from Gallus gallus (chicken) is a multi-pass transmembrane protein with 131 amino acids in its expression region. Its amino acid sequence is: MMNFRQRMGWIGVGLYLLASAAAFYYVFEINETYNKLALEHIQQHPQEPQEGTTWTHSLKVRLLSLPFWLWTIIFLIPYLQMFLFLYSCTRADPKTVGYCIIPICLAVICNRHQTFVKASNQISRLQLIDT .

The protein likely participates in intracellular transport or signaling functions based on comparative analysis with homologs in other species. When studying this protein's structure, researchers should consider its transmembrane topology, which can be predicted using algorithms like TMHMM or Phobius to identify membrane-spanning regions. For experimental structure determination, techniques such as X-ray crystallography and cryo-electron microscopy present challenges due to the protein's membrane-embedded nature. Alternative approaches include NMR spectroscopy of reconstituted protein in membrane mimetics or targeted crosslinking experiments to validate predicted topology models.

What are the optimal storage and handling conditions for recombinant Chicken UPF0694 transmembrane protein?

For optimal stability and activity of recombinant Chicken UPF0694 transmembrane protein, researchers should implement the following methodological approaches:

• Storage conditions: Store the protein at -20°C for regular use, or at -80°C for extended storage periods to minimize degradation .

• Buffer composition: The protein is typically provided in a Tris-based buffer containing 50% glycerol as a cryoprotectant to prevent freeze-thaw damage .

• Aliquoting strategy: To prevent repeated freeze-thaw cycles, divide the stock solution into single-use aliquots before freezing. For working stocks, maintain aliquots at 4°C for up to one week .

• Reconstitution method: When using lyophilized protein, reconstitute in sterile deionized water. For enhanced stability during long-term storage, add glycerol to a final concentration of 5-50%.

• Temperature transitions: Allow frozen protein to thaw completely at 4°C before use, avoiding rapid temperature changes that can cause protein aggregation.

When designing experiments, incorporate stability controls to verify protein integrity throughout the experimental timeline, as membrane proteins are particularly susceptible to denaturation and aggregation during handling procedures.

Which expression systems are most suitable for producing functional recombinant UPF0694 transmembrane protein?

The selection of an appropriate expression system for recombinant UPF0694 transmembrane protein requires careful consideration of several methodological factors:

• Bacterial expression systems: E. coli-based cell-free expression systems are commonly used for initial production attempts due to their simplicity and cost-effectiveness. When using bacterial systems, consider codon optimization for the chicken sequence and fusion tags (His, GST) to enhance solubility and facilitate purification.

• Eukaryotic expression systems: For proper post-translational modifications and folding, yeast (S. cerevisiae or P. pastoris) or mammalian cell lines (HEK293, CHO) may provide superior results. These systems are particularly important if the protein's function depends on glycosylation or specific membrane lipid environments.

• Expression strategy comparison:

• Solubilization approach: Regardless of the expression system, extraction from membranes requires careful optimization of detergents or amphipols to maintain the protein's native structure during purification.

• Verification methods: Confirm proper expression and folding through Western blotting, circular dichroism, and functional assays before proceeding with downstream applications.

What methods are effective for validating the identity and purity of recombinant UPF0694 transmembrane protein?

A comprehensive validation strategy for recombinant UPF0694 transmembrane protein should employ multiple complementary techniques:

• Sequence verification: Confirm protein identity through mass spectrometry analysis, specifically liquid chromatography-tandem mass spectrometry (LC-MS/MS) with tryptic digestion, matching peptide fragments to the expected sequence (MMNFRQRMGWIGVGLYLLASAAAFYYVFEINETYNKLALEHIQQHPQEPQEGTTWTHSLKVRLLSLPFWLWTIIFLIPYLQMFLFLYSCTRADPKTVGYCIIPICLAVICNRHQTFVKASNQISRLQLIDT) .

• Immunological confirmation: Develop or obtain antibodies specific to conserved epitopes of UPF0694 transmembrane protein for Western blot analysis. This approach can leverage the high sequence conservation among species homologs.

• Purity assessment: Implement a multi-method approach:

  • SDS-PAGE with Coomassie or silver staining (≥95% purity standard)

  • Size exclusion chromatography to detect aggregates or degradation products

  • Dynamic light scattering to evaluate size distribution and homogeneity

• Functional validation: Develop activity assays based on predicted functions (e.g., membrane transport, protein-protein interactions) to confirm that the purified protein retains its biological activity.

• Structural integrity: Use circular dichroism spectroscopy to verify secondary structure elements expected for a transmembrane protein, particularly alpha-helical content typical of membrane-spanning domains.

When reporting results, researchers should document all validation methods used and establish clear acceptance criteria for each parameter measured to ensure reproducibility across studies.

What is the evolutionary significance of UPF0694 transmembrane protein conservation across species?

The evolutionary conservation of UPF0694 transmembrane protein across diverse species provides valuable insights for researchers:

• Phylogenetic distribution: Homologs of UPF0694 transmembrane protein exist across multiple vertebrate species including chicken, bovine, human, mouse, and zebrafish, suggesting fundamental biological importance. This conservation pattern indicates selective pressure to maintain protein function throughout vertebrate evolution.

• Comparative sequence analysis:

• Functional implications: The high degree of conservation suggests essential cellular functions, potentially in fundamental processes like:

  • Membrane trafficking or transport

  • Cell signaling pathways

  • Maintenance of cellular homeostasis

  • Structural roles in specific cellular compartments

• Research applications: Evolutionary conservation provides several methodological advantages:

  • Enables cross-species extrapolation of functional data

  • Allows identification of critical functional domains through sequence alignment

  • Facilitates the use of model organisms for functional studies

  • Helps predict protein interactions based on conserved binding motifs

• Computational approach: Researchers should employ multiple sequence alignment tools (MUSCLE, CLUSTAL) followed by conservation analysis (ConSurf, Rate4Site) to identify highly conserved residues likely essential for function, generating testable hypotheses for mutagenesis studies.

How should experiments be designed to investigate the function of UPF0694 transmembrane protein?

Designing robust experiments to elucidate the function of UPF0694 transmembrane protein requires systematic application of experimental design principles:

• Variable definition and hypothesis formulation: Begin by clearly defining your research variables :

  • Independent variables: Protein expression levels, mutant variants, environmental conditions

  • Dependent variables: Cellular phenotypes, protein localization, interaction partners

  • Extraneous variables: Cell type differences, expression system artifacts, tag interference

• Experimental design framework:

• Controls and randomization: Implement rigorous control systems :

  • Positive controls: Well-characterized related transmembrane proteins

  • Negative controls: Empty vector, non-targeting siRNA

  • Randomization: Assign samples randomly to treatment groups to minimize bias

• Between-subjects vs. within-subjects design: For cell-based assays, utilize a between-subjects design with multiple biological replicates. For biochemical characterization, employ within-subjects design with technical replicates of the same protein preparation .

• Validation strategy: Confirm findings through:

  • Multiple experimental approaches targeting the same question

  • Rescue experiments following knockdown/knockout

  • Replication in different cell types or model systems

When publishing results, clearly document all experimental parameters, statistical approaches, and negative findings to facilitate reproducibility and comprehensive understanding of UPF0694 transmembrane protein function .

What approaches are most effective for studying the membrane topology of UPF0694 transmembrane protein?

Deciphering the membrane topology of UPF0694 transmembrane protein requires a multi-faceted methodological approach:

• Computational prediction as starting point: Begin with in silico analysis using multiple transmembrane prediction algorithms (TMHMM, HMMTOP, Phobius) to generate initial topology models. The amino acid sequence (MMNFRQRMGWIGVGLYLLASAAAFYYVFEINETYNKLALEHIQQHPQEPQEGTTWTHSLKVRLLSLPFWLWTIIFLIPYLQMFLFLYSCTRADPKTVGYCIIPICLAVICNRHQTFVKASNQISRLQLIDT) suggests multiple membrane-spanning regions .

• Experimental validation techniques:

• Experimental design considerations:

  • Expression system selection: Mammalian cells provide native-like membrane environment

  • Detergent selection: Critical for maintaining native structure during purification

  • Tag placement: Strategic positioning to minimize functional interference

  • Controls: Include well-characterized membrane proteins with known topology

• Data integration strategy: Combine data from multiple approaches to develop a consensus topology model:

  • Reconcile conflicting data through additional targeted experiments

  • Weight evidence based on methodological strengths and limitations

  • Refine models iteratively as new data becomes available

• Functional correlation: Link topology findings to functional hypotheses by identifying conserved motifs in specific membrane-spanning domains or loops that might participate in transport, signaling, or protein-protein interactions.

How can contradictory data about UPF0694 transmembrane protein be reconciled in scientific literature?

Reconciling contradictory data is a critical challenge in scientific research, particularly for poorly characterized proteins like UPF0694 transmembrane protein. A systematic approach to addressing contradictions includes:

• Context analysis framework: Apply structured analysis to identify potential sources of apparent contradictions :

  • Experimental conditions: Different temperatures, pH, buffer compositions

  • Biological context: Species differences, tissue specificity, developmental stage

  • Methodological variations: Different expression systems, tags, or analytical techniques

  • Incomplete reporting: Underspecified parameters in published methods

• Contradiction categorization: Classify contradictions to guide resolution strategies :

• Data normalization strategy: Develop standardized protocols for:

  • Protein expression and purification

  • Functional assays

  • Data reporting and sharing

• Computational integration: Apply computational approaches to formally represent contradictions :

  • Knowledge graphs to visualize conflicting claims

  • Bayesian inference to weight evidence quality

  • Meta-analysis of multiple datasets

• Collaborative resolution: Establish research collaborations to:

  • Replicate key experiments across laboratories

  • Share reagents and protocols

  • Develop consensus experimental standards

When publishing research on UPF0694 transmembrane protein, explicitly address known contradictions in the literature, propose explanations for discrepancies, and design experiments specifically to resolve them .

What methodological approaches are optimal for identifying protein-protein interactions involving UPF0694 transmembrane protein?

Investigating protein-protein interactions (PPIs) for membrane proteins like UPF0694 transmembrane protein presents unique challenges requiring specialized methodological approaches:

• Comprehensive interaction discovery strategy:

• Sample preparation considerations:

  • Membrane solubilization: Select detergents that maintain protein structure (e.g., DDM, LMNG)

  • Crosslinking optimization: Test multiple crosslinkers with varying spacer lengths

  • Expression levels: Maintain near-physiological levels to avoid artifactual interactions

  • Subcellular fractionation: Isolate relevant membrane compartments to reduce background

• Validation hierarchy:

  • Primary screen: High-throughput methods (BioID, AP-MS)

  • Secondary validation: Orthogonal methods (co-IP, FRET)

  • Functional validation: Mutagenesis of interaction interfaces, functional assays

• Bioinformatic integration:

  • Evolutionary analysis: Co-evolution patterns suggesting interaction partners

  • Domain analysis: Identification of known interaction motifs

  • Network analysis: Integration with existing protein interaction networks

• Experimental design for transmembrane interactions:

  • Strategic truncation constructs to identify interaction domains

  • Competition assays to test binding specificity

  • Lipid dependency analysis to assess environmental requirements

Given the evolutionary conservation of UPF0694, interactions identified in one species should be systematically tested in homologs from other species to distinguish conserved from species-specific interaction networks.

How can comparative analysis of UPF0694 homologs across species inform functional studies?

Leveraging the evolutionary conservation of UPF0694 transmembrane protein provides powerful insights into its function through comparative analysis:

• Systematic comparative framework:

• Strategic model organism selection:

  • Select diverse species with UPF0694 homologs: zebrafish, mouse, Xenopus

  • Leverage the experimental advantages of each model system

  • Design parallel experiments to test conserved hypotheses

• Functional domain identification strategy:

  • Align sequences from chicken (Q5ZLR7), bovine (TMEM251), human (C14orf109), and mouse (Tmem251)

  • Identify 100% conserved residues as likely essential for function

  • Design chimeric proteins swapping domains between species to map functional regions

• Evolutionary rate analysis:

  • Calculate substitution rates across different protein regions

  • Identify domains under purifying selection (slow evolution)

  • Correlate evolutionary rates with predicted functional importance

• Translation to functional hypotheses:

  • Generate testable hypotheses based on conserved features

  • Design complementation experiments across species

  • Evaluate functional redundancy with paralogous proteins

This comparative approach enables researchers to distinguish between core functions conserved through evolution and species-specific adaptations, providing a comprehensive understanding of UPF0694 transmembrane protein biology while maximizing the translational relevance of findings across species.