Recombinant Chicken Vacuolar ATPase assembly integral membrane protein VMA21 (VMA21)

Shipped with Ice Packs
In Stock

Description

Functional Role in V-ATPase Assembly

VMA21 mediates the assembly of V-ATPase’s V₀ domain in the ER:

  1. Yeast Model:

    • Vma21p binds proteolipid subunits (e.g., subunit c′) to form the V₀ ring .

    • Escorts V₀ to the Golgi for V₁ domain binding .

  2. Human Model:

    • Pathogenic mutations (e.g., p.Asn63Gly, p.Arg18Gly) impair V₀ assembly, leading to lysosomal acidification defects and lipid droplet accumulation .

    • Reduced VMA21 levels cause ER stress, cholesterol dysregulation, and autophagic dysfunction .

  3. Chicken Implications:

    • Recombinant chicken VMA21 likely performs analogous roles in V₀ assembly, given structural conservation.

Table 1: Functional Consequences of VMA21 Deficiency

SpeciesDefect ObservedCellular OutcomeCitations
HumanV₀ subunit degradationLysosomal pH alkalization, lipid accumulation
YeastV₀ instability, cytosolic V₁ accumulationGrowth defects in acidic environments
Mouse (CRC)VMA21 overexpressionReduced tumor growth (~50% vs. control)

Table 2: Pathogenic Mutations in Human VMA21

MutationEffect on ProteinClinical Phenotype
c.188A>G (p.Asn63Gly)Reduced mRNA/protein stabilityChronic liver disease, hypercholesterolemia
c.‐10C>TFrameshift, premature stop codonCombined glycosylation disorder (CDG)
c.272C>GSplice defect, reduced VMA21 expressionX-linked myopathy with excessive autophagy (XMEA)

Comparative Analysis of VMA21 Across Species

FeatureHuman VMA21Yeast Vma21pChicken VMA21 (Predicted)
Size8.5 kDa8.5 kDa~8–9 kDa
ER Retention MotifAbsentKKXXLikely present
Key InteractionsATP6AP2, ATP6V0C V₀ proteolipid subunits ATP6AP1/2 homologs
Disease AssociationLiver steatosis, XMEAVacuolar acidosisUnknown

Potential Applications of Recombinant Chicken VMA21

  1. Mechanistic Studies: Elucidate V₀ assembly kinetics in avian systems.

  2. Agricultural Biotechnology: Enhance lysosomal function in poultry cells for disease resistance.

  3. Comparative Pathology: Model human V-ATPase disorders (e.g., XMEA) in avian systems.

Unanswered Questions and Future Directions

  • Does chicken VMA21 have tissue-specific isoforms, as seen in humans ?

  • How do avian-specific mutations affect V-ATPase function?

  • Can recombinant chicken VMA21 rescue defects in VMA21-deficient human cells?

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
VMA21; RCJMB04_5k12; Vacuolar ATPase assembly integral membrane protein VMA21
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-102
Protein Length
full length protein
Species
Gallus gallus (Chicken)
Target Names
VMA21
Target Protein Sequence
MERYDKATLNAAFAPEFRQNEGSLTSTLRTLLFFTALMITLPVGLYFSSKAYIFEGTLGM SNRDSYFYAAIVAVVTVHVVLAMFVYVAWSEGTRQWREGKQD
Uniprot No.

Target Background

Function
Essential for the assembly of the V0 complex of the vacuolar ATPase (V-ATPase) within the endoplasmic reticulum.
Database Links
Protein Families
VMA21 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Endoplasmic reticulum-Golgi intermediate compartment membrane; Multi-pass membrane protein. Cytoplasmic vesicle, COPII-coated vesicle membrane; Multi-pass membrane protein.

Q&A

What is the function of VMA21 protein in cellular physiology?

VMA21 functions as a critical assembly factor for the vacuolar-type H⁺-translocating ATPase (V-ATPase). It serves as a protein chaperone that facilitates the proper assembly of the V₀ sector of the V-ATPase complex . This assembly is essential for generating the proton gradient across lysosomal/vacuolar membranes, which is necessary for proper acidification of these organelles .

The proper assembly of V-ATPase depends on VMA21's chaperone function, and disruption leads to compromised acidification of cellular compartments. In yeast models, mutations in VMA21 result in decreased levels of V₀ subunits at the vacuolar membrane and reduced stability of Vph1 (a V₀ subunit), indicating that VMA21 is essential for V₀ sector assembly integrity . The protein's conservation across species highlights its fundamental importance in cellular physiology.

How does chicken VMA21 differ from mammalian orthologs at the molecular level?

Based on comparative studies, chicken VMA21 shares significant homology with mammalian orthologs, though with species-specific variations. In zebrafish, for example, vma21 shares 70% identity at the protein level with the human gene .

While specific chicken VMA21 sequence data is limited in the provided search results, research on conserved domains suggests that the functional regions are likely maintained across vertebrate species. The C-terminal region appears particularly important, as evidenced by the pathogenicity of C-terminal mutations like VMA21p.93X in humans . When investigating chicken VMA21, researchers should anticipate that:

  • Functional domains involved in V-ATPase assembly are likely conserved

  • Species-specific variations may exist in non-catalytic regions

  • Post-translational modifications might differ between chicken and mammalian VMA21

What experimental methods are recommended for detecting VMA21 protein expression in avian tissues?

For effective detection of VMA21 protein expression in avian tissues, researchers should employ multiple complementary techniques:

Western Blot Analysis:

  • Use antibodies targeting conserved regions of VMA21

  • Include appropriate controls (both positive and negative)

  • Consider subcellular fractionation to examine VMA21 localization

Western blot has been successfully used to confirm Vma21 protein levels in animal models, as demonstrated in zebrafish studies where mutations led to decreased Vma21 protein levels compared to wild-type and heterozygous controls .

Immunohistochemistry/Immunofluorescence:

  • Particularly useful for tissue-specific expression patterns

  • Can reveal subcellular localization of VMA21

qRT-PCR:

  • For quantifying VMA21 transcript levels

  • Useful when protein detection is challenging

  • Can reveal tissue-specific expression patterns

Reduced VMA21 transcript levels have been documented in patient fibroblasts (approximately 40% of normal levels), suggesting that transcript quantification is an effective approach to assess VMA21 expression .

How do mutations in VMA21 affect V-ATPase assembly and function?

Mutations in VMA21 significantly impair V-ATPase assembly and function through several mechanisms:

Disruption of V₀ Sector Assembly:

  • In yeast models with the Vma21[Δ66-77] mutation (corresponding to human VMA21p.93X), both total cellular and vacuolar levels of Vph1 (a critical V₀ subunit) were significantly reduced compared to wild-type cells

  • Assembly defects lead to decreased levels of correctly formed V-ATPase complexes at the vacuolar membrane

Compromised V-ATPase Activity:

  • Loss of functional VMA21 results in impaired acidification of lysosomes/vacuoles

  • Leads to increased vacuolar pH and disrupted proton gradient across vacuolar membranes

Altered Protein Stability:

The consequences of these assembly defects extend beyond just V-ATPase function. In both patient cells and model systems, VMA21 mutations lead to compromised lysosomal function, aberrant autophagy, and disrupted amino acid homeostasis. In Vma21[Δ66-77] yeast cells, vacuolar levels of histidine, lysine, and arginine were significantly reduced, suggesting broad metabolic implications .

What tissue-specific effects of VMA21 dysfunction have been documented in research models?

Research models have revealed that VMA21 dysfunction affects multiple tissues with varying manifestations:

Muscle Tissue Effects:

  • Progressive vacuolization and atrophy of skeletal muscle

  • Formation of characteristic autophagic vacuoles within myofibers

  • Increased LC3 protein levels and reduced autophagic flux

  • In human patients, proximal muscle weakness and progressive vacuolation

Liver Tissue Effects:

  • Hepatic steatosis and decreased liver size

  • Impaired bile flux

  • Mild cholestasis and chronic elevation of aminotransferases

  • Elevation of low-density lipoprotein cholesterol

Systemic Effects:

  • Abnormal protein glycosylation

  • Immunosuppression observed in some models

  • Impaired growth and development

  • Reduced survival in zebrafish models

How can recombinant VMA21 be effectively expressed and purified for functional studies?

For effective expression and purification of recombinant chicken VMA21 for functional studies, researchers should consider the following methodological approaches:

Expression System Selection:

Expression SystemAdvantagesConsiderations
E. coliHigh yield, cost-effectiveMay lack post-translational modifications
Insect cellsBetter for membrane proteinsMore complex system
Mammalian cellsNative-like processingLower yields, higher cost
YeastGood for membrane proteinsDifferent glycosylation patterns

Purification Strategy:

  • Affinity tags (His, GST, or FLAG) should be positioned to avoid interference with functional domains

  • Detergent selection is crucial for membrane protein solubilization

  • Size exclusion chromatography for final purification step

Functional Verification:

  • In vitro V-ATPase assembly assays

  • Co-immunoprecipitation with V-ATPase components

  • Liposome reconstitution for functional assessment

When working with chicken VMA21, it's important to note that as an integral membrane protein, it contains hydrophobic regions that make purification challenging. Therefore, careful optimization of detergent conditions is essential to maintain protein stability and functionality throughout the purification process. Additionally, considering that VMA21 functions as a chaperone, its interaction with other proteins should be preserved or accounted for when designing functional assays.

What are the molecular mechanisms underlying VMA21's role in autophagy regulation?

VMA21's role in autophagy regulation involves a complex interplay between V-ATPase function, lysosomal acidification, and autophagic machinery:

Primary Mechanism: Lysosomal Acidification

  • VMA21 ensures proper V-ATPase assembly, which is essential for lysosomal acidification

  • Loss of VMA21 function leads to lysosomal de-acidification, as demonstrated by reduced LysoTracker Red and Lamp1 staining in zebrafish models

  • Impaired lysosomal acidification inhibits the activity of pH-dependent lysosomal hydrolases

Autophagy Flux Disruption

  • VMA21 dysfunction causes accumulation of autophagosomes and formation of characteristic autophagic vacuoles

  • Zebrafish vma21 mutants showed increased LC3 protein levels and reduced autophagic flux

  • The block in autophagy completion leads to compensatory upregulation of autophagy initiation

Nutrient Sensing and Amino Acid Homeostasis

  • VMA21 mutations affect vacuolar/lysosomal amino acid levels

  • In yeast models, Vma21[Δ66-77] mutation resulted in significantly reduced vacuolar levels of histidine, lysine, and arginine

  • Altered amino acid homeostasis affects mTOR signaling, further influencing autophagy regulation

Therapeutic Implications

  • Zebrafish studies showed that autophagy modulators (particularly edaravone and LY294002) improved survival and motor function in vma21 mutants

  • These findings suggest that targeting autophagy pathways may provide therapeutic benefit in VMA21-related disorders

The interconnected nature of these mechanisms creates a complex pathological cascade where initial V-ATPase dysfunction leads to broad disruption of cellular homeostasis, particularly affecting tissues with high metabolic demands.

What experimental approaches can distinguish between primary VMA21 dysfunction and secondary autophagy disruption in pathological samples?

Distinguishing between primary VMA21 dysfunction and secondary autophagy disruption in pathological samples requires sophisticated experimental approaches:

Lysosomal Acidification Assessment:

  • LysoTracker or LysoSensor dyes to quantify lysosomal pH

  • Ratiometric pH measurements in isolated lysosomes

  • These measurements can determine if lysosomal acidification defects precede autophagy disruption

In zebrafish models, impaired lysosomal acidification was demonstrated by the absence of LysoTracker Red staining, establishing it as a primary defect .

V-ATPase Assembly Analysis:

  • Co-immunoprecipitation of V-ATPase components to assess complex integrity

  • Blue native PAGE to examine intact V-ATPase complexes

  • Western blot analysis of V₀ subunit levels (Vph1/ATP6V0A4 homologs)

Studies in yeast demonstrated that both total cellular and vacuolar levels of the V₀ subunit Vph1 were significantly reduced in Vma21[Δ66-77] cells, confirming V-ATPase assembly as the primary defect .

Temporal Analysis of Molecular Events:

  • Time-course experiments to establish sequence of molecular events

  • Inducible expression systems to monitor immediate consequences of VMA21 loss

Genetic Rescue Experiments:

  • Complementation with wild-type VMA21 to reverse phenotypes

  • Specific rescue of V-ATPase assembly versus autophagy function

Differential Response to Interventions:

  • V-ATPase-specific modulators versus autophagy modulators

  • In zebrafish, treatment with autophagy antagonists (edaravone and LY294002) improved survival and motor function but did not affect impaired bile flux, suggesting differential responses of various pathological features

ApproachPrimary VMA21 DysfunctionSecondary Autophagy Disruption
V-ATPase activity assaySignificantly reducedMay be normal or mildly affected
Lysosomal pHElevatedMay be normal
V₀ sector assemblyDisruptedIntact
Response to VMA21 rescueComplete reversalPartial improvement
Transcript analysisVMA21 reductionNormal VMA21 levels

By employing these approaches, researchers can establish causality in the pathogenic cascade and determine whether autophagy disruption is a direct consequence of VMA21 dysfunction or results from independent pathological processes.

What cross-species conservation patterns in VMA21 function can inform research on chicken V-ATPase assembly?

Cross-species conservation analysis of VMA21 reveals important patterns that can guide research on chicken V-ATPase assembly:

Functional Domain Conservation:

  • The core functional domains of VMA21 are highly conserved across species

  • Zebrafish vma21 shares 70% identity at the protein level with human VMA21

  • This conservation suggests that fundamental mechanisms of V-ATPase assembly are likely preserved in chickens

Species-Specific Variations:

  • Despite functional conservation, species-specific variations exist

  • In follicular lymphoma studies, the VMA21p.93X mutation (corresponding to Vma21[Δ66-77] in yeast) showed subtle differences in its effects between human and yeast cells

  • These differences highlight the importance of species-specific validation

Evolutionary Adaptations:

  • Variations in VMA21 sequence and function may reflect evolutionary adaptations to different cellular environments

  • Birds may have specific adaptations in V-ATPase assembly related to their unique metabolic requirements

Cross-Species Functional Complementation:

  • Studies testing whether chicken VMA21 can complement defects in yeast or mammalian cells would be particularly informative

  • Such complementation studies could identify both conserved and divergent functional elements

Pathology Patterns:

  • Disease manifestations related to VMA21 dysfunction show similarities across species

  • In humans, manifestations include myopathy and liver dysfunction

  • In zebrafish models, similar patterns of muscle and liver involvement are observed

  • These similarities suggest conserved tissue vulnerabilities to V-ATPase dysfunction

Understanding these conservation patterns can guide experimental design when working with chicken VMA21, allowing researchers to leverage findings from model organisms while accounting for avian-specific biology. The high degree of functional conservation suggests that key insights from mammalian and yeast models are likely applicable to chicken V-ATPase assembly, though with potential modifications reflecting avian physiology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.