Recombinant Chicken Voltage-dependent L-type calcium channel subunit alpha-1C (CACNA1C)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timelines, please contact your local distributor.
All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference for your own preparation.
Shelf Life
Shelf life can be affected by various factors such as storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please communicate this to us, and we will prioritize developing the specified tag.
Synonyms
CACNA1C; Voltage-dependent L-type calcium channel subunit alpha-1C; CHCACHA1C; Voltage-gated calcium channel subunit alpha Cav1.2; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-177
Protein Length
Full length protein
Species
Gallus gallus (Chicken)
Target Names
Target Protein Sequence
ALIVVGSIVDIAITEVNNAEENSRISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQ ALPYVALLIVMLFFIYAVIGMQVFGKIALNDTTEINRNNNFQTFPQAVLLLFRCATGEAW QEIMLACLPDKKCDPDSEPANSTEADHSCGSSFAVFYFISFYMLCAFLIIDLFVAVI
Uniprot No.

Target Background

Function
This protein is the pore-forming, alpha-1C subunit of the voltage-gated calcium channel responsible for generating L-type calcium currents. It mediates the influx of calcium ions into the cytoplasm, triggering calcium release from the sarcoplasm. This protein plays a crucial role in excitation-contraction coupling within the heart. It is essential for normal heart development and regulation of heart rhythm. Additionally, it is required for the proper contraction of smooth muscle cells in blood vessels and the intestine, making it vital for normal blood pressure regulation through its role in arterial smooth muscle cell contraction. Long-lasting (L-type) calcium channels are classified as 'high-voltage activated' (HVA) channels.
Database Links

STRING: 9031.ENSGALP00000021218

UniGene: Gga.525

Protein Families
Calcium channel alpha-1 subunit (TC 1.A.1.11) family, CACNA1C subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Perikaryon. Cell junction, synapse, postsynaptic density membrane. Cell projection, dendrite. Cell membrane, sarcolemma, T-tubule.

Q&A

What is the basic structure and function of the CACNA1C-encoded calcium channel?

CACNA1C encodes the voltage-dependent L-type calcium channel subunit alpha-1C, which forms the CaV1.2 channel. This channel is critical for calcium ion transport into cells and plays key roles in:

  • Regulating electrical activity of cells

  • Cell-to-cell communication

  • Muscle contraction

  • Gene regulation, particularly in brain and bone development

Structurally, the CaV1.2 channel contains 24 transmembrane-spanning segments arranged in four homologous sets (DI-DIV) with pseudo-fourfold symmetry. Each set contains six transmembrane-spanning segments where:

  • Segments S1-S4 form the voltage sensor domain

  • Segments S5-S6 form the ion pore

The channel displays a domain-swapped architecture as confirmed by cryo-EM structures, where the voltage sensor domain from one pseudorepeat is positioned next to the pore domain of its neighbor rather than its own pore domain .

How does CACNA1C expression vary across different tissues?

CaV1.2 channels are expressed in multiple tissues with varying distribution patterns:

TissueExpression LevelFunctional RoleCitation
HeartHighControls calcium flow into cardiomyocytes at each heartbeat
BrainHigh (hippocampus, cortex)Involved in memory, fear response, and rapid transmission of nerve signals
Smooth musclePresentMuscle contraction
LiverPresentCell signaling
KidneyPresentCell signaling

In the brain, CaV1.2 can be detected specifically in the hippocampus and brain cortex in the post-synaptic density and neuronal cell bodies . This differential expression correlates with tissue-specific functions and may explain why mutations in this gene can affect multiple systems including cardiovascular and neurological functions.

What are the most effective methods for expressing recombinant CACNA1C protein?

Multiple expression systems have been successfully used to produce recombinant CACNA1C protein:

Expression SystemAdvantagesConsiderationsCitation
E. coliHigh yield, cost-effectiveLimited post-translational modifications
YeastBetter for folding, some post-translational modificationsModerate yield
BaculovirusHigh expression of functional protein, complex modificationsMore expensive, longer production time
Mammalian cellsNative-like post-translational modifications, proper foldingLower yield, highest cost

For functional studies, researchers should consider:

  • Including accessory subunits: Co-express CACNA1C with CaVβ and α2δ-1 subunits for proper channel assembly and trafficking

  • Fusion tags: His-tag is commonly used for purification purposes

  • Expression verification: Confirm expression using Western blot with specific antibodies

The choice of expression system should align with your experimental goals - use E. coli for structural studies requiring high protein yield, and mammalian systems for functional assays requiring native-like channel properties .

What approaches are most effective for studying CACNA1C function in animal models?

Several genetic approaches have proven valuable for studying CACNA1C function:

  • Conditional knockout models: Forebrain-specific conditional knockout of cacna1c (forebrain-CaV1.2 cKO) using CaMKII-Cre-mediated recombination has been effective for studying behavioral phenotypes . This approach allows:

    • Circumvention of early developmental compensatory adaptations by activating Cre expression at postnatal day 18

    • Investigation of specific brain regions without affecting peripheral CACNA1C expression

  • Verification methods:

    • Immunohistochemistry for CaV1.2 to confirm elimination

    • qPCR using cacna1c-specific primers (e.g., Qiagen QuantiTect Primer assay QT00150752)

    • Functional verification through electrophysiology

These approaches allow for temporal and spatial control of CACNA1C expression, enabling researchers to distinguish between developmental and acute effects of CACNA1C manipulation.

How can researchers effectively characterize the full range of CACNA1C splice variants?

Recent research has revealed that CACNA1C's transcript profile is substantially more complex than previously appreciated. A novel approach combining long-range PCR and nanopore sequencing with specialized bioinformatics identified:

  • 38 previously unknown exons

  • 241 novel transcripts

To characterize CACNA1C splice variants, researchers should consider:

  • Long-read sequencing approach: Traditional short-read sequencing methods miss many complex splicing events. Long-read nanopore sequencing provides full-length transcript identification .

  • Tissue-specific analysis: Expression patterns vary significantly between tissues, with particular divergence in cerebellum compared to other brain regions .

  • Quantitative PCR validation: Use isoform-specific primers to validate and quantify expression levels of identified variants.

  • Functional characterization: Determine the functional consequences of alternative splicing through electrophysiological recordings of recombinantly expressed splice variants.

This comprehensive approach is essential because many newly identified variants are abundant and predicted to encode channels with altered functions, which may contribute to disease pathophysiology .

What is known about the functional differences between CACNA1C splice variants?

Alternative splicing of CACNA1C produces functionally diverse channel isoforms with tissue-specific distribution patterns:

Splice VariantTissue DistributionFunctional CharacteristicsPotential Significance
Exon 8 variant~80% in heart and brainStandard CaV1.2 functionPredominant form in excitable tissues
Exon 8A variant~20% in heart and brainAltered channel propertiesMay contribute to tissue-specific functions
Novel variants (from recent sequencing)Variable, brain region-specificPredicted altered functionsMay relate to neuropsychiatric disease mechanisms

The functional significance of this diversity includes:

  • Tissue-specific regulation: Different variants may respond differently to regulatory mechanisms

  • Pharmacological responses: Splice variants may exhibit differential sensitivity to calcium channel blockers

  • Disease associations: Certain variants may confer vulnerability to specific pathological conditions

Researchers investigating CACNA1C function should account for this splice variant diversity in experimental design, as studying only one variant may yield incomplete or misleading results .

How does CACNA1C contribute to neuropsychiatric disorders?

CACNA1C has been consistently identified as a cross-disorder risk gene for multiple psychiatric conditions:

DisorderEvidence StrengthEffect SizeKey Research FindingsCitation
Bipolar DisorderGenome-wide significanceOR = 1.07-1.18SNPs consistently associated across multiple studies
SchizophreniaGenome-wide significanceOR = 1.07-1.18Variants confer ~0.06% absolute increase in lifetime risk
Major DepressionSupportive but less consistentVariableLess robust association than for bipolar/schizophrenia

Mechanistically, CACNA1C variants appear to affect:

  • Neuronal development: Forebrain-CaV1.2 conditional knockout mice exhibit enhanced cell death of young hippocampal neurons

  • Neurotrophic signaling: These mice show deficits in brain-derived neurotrophic factor (BDNF) levels

  • Gene-environment interactions: CACNA1C interacts with environmental factors like chronic stress to shape disease vulnerability

Research methods to investigate these mechanisms include:

  • Conditional knockout models with temporal control (CaMKII-Cre T29-1 line)

  • BrdU labeling to assess neurogenesis (50 mg/kg for 5 days)

  • Fluorescent immunohistochemistry for doublecortin to analyze cells committed to neuronal fate

  • ELISA for BDNF quantification in brain tissue

These findings suggest that CACNA1C plays a complex role in psychiatric disorders, likely through effects on neurodevelopment, stress responses, and neurotrophic signaling.

What experimental approaches are most useful for studying CACNA1C mutations associated with cardiac arrhythmias?

CACNA1C mutations are associated with several cardiac disorders including Timothy syndrome, Brugada syndrome, and Long QT syndrome. Effective experimental approaches include:

  • Recombinant expression systems:

    • Express wild-type and mutant CACNA1C in heterologous systems (HEK293 cells)

    • Co-express with accessory subunits (CaVβ and α2δ-1)

    • Perform electrophysiological characterization using whole-cell patch-clamp techniques

  • Structure-function analysis:

    • Site-directed mutagenesis to create specific variants (e.g., G419R, associated with prolonged QT interval)

    • Analysis of biophysical parameters including:

      • Peak current density

      • Voltage-dependence of activation and inactivation

      • Channel kinetics

      • Window currents

  • Regulatory mechanism investigation:

    • Examine the role of calmodulin (CaM) in channel modulation using:

      • CaM overexpression

      • Phosphomimetic (T79D, S81D) and phosphoresistant (T79A, S81A) CaM surrogates

      • CaM antagonists (e.g., W-13)

Recent research on the G419R variant demonstrated how this mutation promotes stronger channel activity at physiological voltages. This single amino acid change leads to:

  • Increased peak current density

  • Leftward shift in voltage-dependence of activation

  • Similar effect to constitutive activation by calmodulin

These approaches allow researchers to connect specific molecular alterations to clinical phenotypes and potential therapeutic strategies.

What are the most effective strategies for targeting CACNA1C channels in neuroprotection research?

CACNA1C channels represent promising targets for neuroprotection, particularly in disorders with aberrant hippocampal neurogenesis. Research strategies include:

  • Pharmacological approaches:

    • L-type calcium channel modulators

    • Neuroprotective agents that bypass BDNF deficiency

      • The P7C3-A20 compound restored hippocampal neurogenesis in forebrain-CaV1.2 cKO mice without affecting BDNF levels

  • Therapeutic target evaluation:

    • Assess young hippocampal neuron survival using BrdU labeling and doublecortin immunostaining

    • Evaluate BDNF levels with ELISA-based methods

    • Test behavioral outcomes in relevant domains (anxiety, cognition)

  • Mechanistic insights from knockout models:

    • Forebrain-CaV1.2 cKO mice show:

      • Enhanced death of young hippocampal neurons

      • No changes in neural precursor cell proliferation

      • No changes in hippocampal size or dentate gyrus thickness

      • Normal corticosterone levels

These findings suggest that CACNA1C-targeted neuroprotective strategies should focus on enhancing young neuron survival rather than stimulating proliferation. The efficacy of P7C3-A20 in restoring neurogenesis without affecting BDNF indicates that targeting downstream pathways may provide a promising approach for treating neuropsychiatric diseases associated with CACNA1C aberrations .

How can engineered inhibitors be developed for specific modulation of CACNA1C channels?

Development of specific modulators for CACNA1C channels requires sophisticated protein engineering approaches:

  • Nanobody-based approaches:

    • Nanobodies (small single-domain antibody fragments) can be engineered for high specificity

    • Functional screening using electrophysiology identifies candidates that specifically modulate channel properties

    • Fusion with regulatory domains (e.g., PKCγ C1 domain) can create inducible modulators

  • Ubiquitin ligase-based degradation:

    • Engineering fusion proteins that combine channel-binding domains with E3 ubiquitin ligases (e.g., Nedd4L)

    • This approach can promote selective degradation of calcium channels

    • Requires validation using flow cytometry, immunoblotting, and electrophysiology to confirm reduced channel expression and function

  • Structure-guided design:

    • Utilize cryo-EM structures of calcium channels to identify key interaction sites

    • Design peptide or small molecule inhibitors that target specific domains or interfaces

    • Virtual screening approaches to identify lead compounds

These approaches offer potential advantages over traditional calcium channel blockers by providing:

  • Increased specificity for CACNA1C (CaV1.2) over other calcium channel types

  • Ability to target specific splice variants or mutant forms

  • Reduced off-target effects on other ion channels or signaling pathways

What are the most reliable antibodies and detection methods for studying CACNA1C in various experimental contexts?

Several validated antibodies are available for CACNA1C detection:

AntibodyApplicationsSpecies ReactivityEpitope/Target RegionCitation
L57/46 monoclonalIHC, ICC, IP, WBGuinea pig, human, mouse, ratIntracellular C-terminus (aa 1507-1733)
N263/31 monoclonalICC, IHC, WBHuman, mouse, ratNot specified
21774-1-AP polyclonalWB, IHC, IF-P, FCHuman, mouse, ratNot specified

For optimal detection:

  • Western blot protocols:

    • Expected molecular weight: 240 kDa (varies with glycosylation)

    • Recommended dilutions: 1:500-1:2000

    • Use mouse heart tissue as positive control

  • Immunohistochemistry protocols:

    • Recommended dilutions: 1:100-1:800

    • Antigen retrieval: TE buffer pH 9.0 or citrate buffer pH 6.0

    • Positive tissues: Mouse/rat brain, mouse liver

  • Fluorescence techniques:

    • Immunofluorescence dilutions: 1:50-1:500

    • Flow cytometry: 0.40 μg per 10^6 cells in 100 μl suspension

    • HeLa cells can be used as positive control for flow cytometry

Verification of antibody specificity is critical, particularly when studying specific splice variants or in tissues with complex expression patterns.

What are the key considerations when designing experiments with recombinant CACNA1C proteins?

When working with recombinant CACNA1C proteins, researchers should consider:

  • Protein stability and storage:

    • Store lyophilized protein at -20°C/-80°C

    • For reconstituted protein:

      • Use deionized sterile water (0.1-1.0 mg/mL)

      • Add 5-50% glycerol for long-term storage

      • Avoid repeated freeze-thaw cycles

      • Working aliquots can be stored at 4°C for up to one week

  • Expression systems selection:

    • E. coli: Suitable for partial fragments or domains

    • Yeast: Better for larger fragments with some post-translational modifications

    • Mammalian cells: Optimal for full-length functional channels

  • Functional considerations:

    • Full-length CACNA1C requires co-expression with auxiliary subunits (β and α2δ) for proper function

    • Different β subunit isoforms (β1-β4) confer distinct biophysical properties

    • Consider using cell lines with minimal endogenous calcium channel expression

  • Species differences:

    • Chicken CACNA1C has high homology but some functional differences from mammalian orthologs

    • When using chicken CACNA1C as a model, validate findings in mammalian systems when possible

By carefully considering these factors, researchers can design more robust experiments and avoid technical pitfalls that may confound interpretation of results.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.