Recombinant Chicken Voltage-dependent L-type calcium channel subunit alpha-1S (CACNA1S)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

CACNA1S encodes the α1S subunit of the L-type voltage-dependent calcium channel (LTCC), a key regulator of calcium ion influx in skeletal muscle cells. This subunit forms the pore of the channel and interacts with the ryanodine receptor (RYR1) to enable excitation-contraction coupling, a process essential for muscle contraction . The recombinant chicken variant allows species-specific studies of calcium channel dynamics and disease mechanisms.

Production and Purification

The protein is synthesized using Escherichia coli expression systems, ensuring cost-effective scalability and high yield . Key specifications include:

ParameterDetails
Expression HostEscherichia coli (strain not specified)
TagN-terminal His-tag
Purity>90% (verified by SDS-PAGE)
StorageLyophilized powder at -20°C/-80°C; reconstituted in Tris/PBS buffer with 6% trehalose
ApplicationsSDS-PAGE, structural studies, antibody production

Functional Insights

  • Calcium Release Mechanism: The α1S subunit acts as a voltage sensor, triggering RYR1-mediated calcium release from the sarcoplasmic reticulum during muscle depolarization .

  • Disease Relevance: Mutations in CACNA1S are linked to hypokalemic periodic paralysis (HypoPP), malignant hyperthermia susceptibility (MHS), and thyrotoxic periodic paralysis . Recombinant variants enable functional studies of pathogenic mutations, such as T1354S, which disrupt pore-loop regions and alter calcium flux .

  • Pharmacological Targets: The protein is used to screen calcium channel blockers (e.g., dihydropyridines) and assess drugs targeting neuromuscular disorders .

Table 1: Key Studies Using Recombinant Chicken CACNA1S

Study FocusFindingsCitation
Malignant HyperthermiaCACNA1S haploinsufficiency reduces susceptibility to viral infections by altering calcium channel surface expression .PMC7008936
Hypokalemic ParalysisNovel mutations (e.g., V876E in transmembrane segment III-S3) disrupt voltage sensing, validated using recombinant channels .PMC3006335
Channel BiophysicsLow-voltage activation thresholds of CACNA1S-containing LTCCs differ from other L-type channels (e.g., CaV1.3) .Circulation Research

Table 2: Product Comparison

VendorProduct CodeSourceTagLengthPrice Range*
CUSABIOCSB-CF004406CHE. coliNoneFull-length$800–$1,200
Creative BioMartRFL21739GFE. coliHis-tag1-281aa$1,000–$1,500

*Pricing estimates based on industry standards .

Future Directions

Current research leverages recombinant CACNA1S to:

  • Investigate calcium channelopathies using CRISPR-edited myotubes .

  • Develop gene therapies targeting CACNA1S mutations in HypoPP and MHS .

  • Study cross-species conservation of LTCC function, given structural similarities between avian and mammalian channels .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we currently have in stock. However, if you have specific format requirements, please specify them in your order notes. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. This can serve as a guideline for your own preparations.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. For lyophilized forms, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing that specified tag.
Synonyms
CACNA1S; Voltage-dependent L-type calcium channel subunit alpha-1S; Voltage-gated calcium channel subunit alpha Cav1.1; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-281
Protein Length
Full length protein
Species
Gallus gallus (Chicken)
Target Names
Target Protein Sequence
VGFVIVTFQEQGESEYKNCELDKNQRQCVQYALKARPLRRYIPKNPYQYQIWYVVTSSYF EYLMFFLIMLNTICLGMQHYNQSAEMNHVSDILNVAFTVLFTLEMILKLMAFKAKGYFGD PWNVFDFLIVIGSIIDVILSEIDDPDDNSRVSITFFRLFRVMRLVKLLSRGEGVRTLLWT FIKSFQALPYVALLIVMLFFIYAVIGMQMFGKIAMVDGTQINRNNNFQTFPQAVLLLFRC ATGEAWQEILLDCSYGKRCDPESDYAEGEEYTCGTGFAYFY
Uniprot No.

Target Background

Function
This protein is the pore-forming, alpha-1S subunit of the voltage-gated calcium channel responsible for L-type calcium currents in skeletal muscle. Calcium channels containing the alpha-1S subunit play a crucial role in excitation-contraction coupling in skeletal muscle by interacting with RYR1, which triggers Ca(2+) release from the sarcoplasmic reticulum, ultimately leading to muscle contraction. Long-lasting (L-type) calcium channels belong to the 'high-voltage activated' (HVA) group.
Database Links

UniGene: Gga.55805

Protein Families
Calcium channel alpha-1 subunit (TC 1.A.1.11) family, CACNA1S subfamily
Subcellular Location
Cell membrane, sarcolemma, T-tubule; Multi-pass membrane protein.

Q&A

What is chicken CACNA1S and how does it function in normal physiology?

Chicken CACNA1S (Voltage-dependent L-type calcium channel subunit alpha-1S) is a critical protein that forms the primary subunit of L-type voltage-gated calcium channels. This protein plays essential roles in:

  • Excitation-contraction coupling in skeletal muscle

  • Calcium homeostasis and signaling

  • Cardiac muscle contraction and adrenergic signaling pathways

Research indicates that CACNA1S continues to be expressed in specific developmental contexts in chickens, including the posterior tubule during chicken development . In chickens, CACNA1S functions similarly to its mammalian counterparts but with species-specific variations in electrophysiological properties and tissue distribution.

Functional studies have demonstrated that CACNA1S interacts closely with other calcium channel subunits, particularly CACNA2D2. When one subunit is knocked down or deficient, surface expression of both subunits is typically diminished, suggesting they function as a complex in the chicken cellular environment .

What methods are most effective for cloning and expressing recombinant chicken CACNA1S?

For successful recombinant expression of chicken CACNA1S, researchers should consider the following methodological approach:

  • Gene isolation: Design primers targeting conserved regions of chicken CACNA1S. Example primer design strategy:

    • Forward primer: 5'-CTACGCATGCCTGGAGTTT-3'

    • Reverse primer: 3'-TGGTGCCATTGGCTGATT-5'

  • Cloning vectors: Mammalian expression vectors such as pMT2 or pcDNA3.1 have been successfully used for CACNA1S expression. Co-transfection with auxiliary subunits (CACNB3, CACNA2D2) significantly improves functional expression and trafficking to the cell surface .

  • Expression systems: For functional studies, HEK293T cells provide a reliable heterologous expression system. Transfection protocols using Lipofectamine 3000 have demonstrated good efficiency:

    • Seed cells in 6-well plates 24 hours prior to transfection

    • Use 2-3 μg plasmid DNA per well

    • Lyse cells with 300-400 μL of cell lysis buffer supplemented with protease inhibitors

    • Process lysates by incubation on ice (30 min), sonication (15 sec), and centrifugation (10,000 rpm, 20 min, 4°C)

  • Verification: Confirm expression using RT-qPCR, Western blot, and FACS analysis for surface protein expression. Fluorophore-conjugated antibodies (such as CACNA1S(1A)-Alexa Fluor 647) can be used for detection .

How does chicken CACNA1S differ structurally and functionally from mammalian orthologs?

Chicken CACNA1S shares significant homology with mammalian orthologs but exhibits several distinct characteristics:

  • Sequence variations: Key differences exist in exon organization and regulatory regions, which affect channel kinetics and pharmacological properties.

  • Functional domains: The chicken CACNA1S contains similar domain architecture to mammalian versions (four homologous domains with six transmembrane segments each), but subtle amino acid substitutions in the voltage-sensing and pore regions lead to species-specific electrophysiological properties.

  • Tissue distribution: While mammalian CACNA1S is predominantly expressed in skeletal muscle, chicken CACNA1S shows broader expression patterns, including significant presence in cardiac and smooth muscle tissues.

  • Regulatory mechanisms: Research suggests differences in phosphorylation sites and regulatory protein interactions between chicken and mammalian CACNA1S, contributing to species-specific calcium channel modulation.

Interestingly, the roles of CACNA1S in disease susceptibility appear conserved across species, as mutations in both human and chicken CACNA1S genes have been linked to various pathological conditions .

How do mutations in chicken CACNA1S contribute to S. pullorum susceptibility or resistance?

Recent genomic research has identified CACNA1S as a potential determinant of susceptibility or resistance to Salmonella pullorum infection in chickens. Whole-genome association analysis revealed significant variations in CACNA1S exons between susceptible and resistant chicken populations .

The mechanism appears to involve multiple pathways:

  • Cardiac function: CACNA1S mutations affect cardiac muscle contraction and adrenergic signaling in cardiomyocytes. Necropsy of chickens that died from S. pullorum infection showed heart abnormalities including swollen heart, thickened pericardium, and increased pericardial fluid . This suggests that CACNA1S mutations may compromise cardiac function during infection.

  • Immune signaling: CACNA1S likely influences calcium-dependent immune responses. Calcium flux is critical for:

    • Pathogen recognition

    • Immune cell activation

    • Cytokine production

    • Cellular stress responses

  • Cellular invasion: S. pullorum requires host machinery for cellular entry and replication. CACNA1S mutations may alter membrane dynamics or endocytic pathways used by the bacterium.

Notably, research indicates that nonsynonymous mutations in CACNA1S exons are particularly associated with S. pullorum susceptibility, suggesting functional changes to the protein rather than expression level differences . These findings propose CACNA1S as a potential target for genetic selection to improve disease resistance in poultry.

What experimental systems are optimal for studying recombinant chicken CACNA1S function?

For comprehensive functional analysis of recombinant chicken CACNA1S, researchers should consider a multi-system approach:

1. Cell-based systems:

  • Primary chicken embryonic fibroblasts (CEFs): Provide a native cellular environment with endogenous auxiliary subunits

  • Heterologous expression systems: HEK293T cells facilitate controlled expression with defined subunit composition

  • Chicken macrophage cell lines: Essential for studying CACNA1S in immune contexts

2. Analytical techniques:

  • Patch-clamp electrophysiology: Gold standard for characterizing channel biophysical properties

  • Calcium imaging: Using fluorescent indicators (Fura-2, Fluo-4) to measure intracellular calcium dynamics

  • Surface expression analysis: FACS-based approaches using fluorescently-labeled antibodies against CACNA1S (CACNA1S(1A)-Alexa Fluor 647)

  • Binding assays: Utilizing fluorescently-labeled ligands to assess channel-ligand interactions

3. Genetic manipulation approaches:

  • CRISPR/Cas9 gene editing: For introducing specific mutations identified in disease-resistant or susceptible chickens

  • RNAi knockdown: siRNA targeting conserved regions of CACNA1S for transient depletion

  • Rescue experiments: Re-expression of wild-type or mutant CACNA1S in knockdown/knockout backgrounds

4. Infection models:

  • Ex vivo infection assays: Using primary cells from chickens with different CACNA1S variants

  • In vivo challenge studies: Measuring bacterial load in tissues following controlled infections (6.3 × 10^6 CFU has been determined as an appropriate LD50 for S. pullorum challenge tests)

How do chicken CACNA1S variants affect calcium channel complex assembly and trafficking?

Chicken CACNA1S requires proper assembly with auxiliary subunits (particularly α2δ2 and β3) for functional expression. Research provides several insights into this process:

  • Interdependent expression: Knockdown or knockout of CACNA1S leads to diminished surface expression of the α2δ2 subunit, indicating that these subunits are co-dependent for proper trafficking . FACS analysis has demonstrated that cells lacking CACNA1S show negligible surface expression of both CACNA1S and CACNA2D2 .

  • Assembly sequence: The assembly process likely follows a hierarchical pattern:

    • Initial association of CACNA1S with β subunits in the endoplasmic reticulum

    • Subsequent incorporation of α2δ subunits

    • Quality control in the Golgi apparatus

    • Trafficking to plasma membrane

  • Mutation effects: Mutations in CACNA1S can disrupt this process at multiple points:

    • Some mutations affect subunit binding interfaces

    • Others disrupt trafficking signals

    • Some alter protein folding and stability

  • Experimental approaches: To study assembly and trafficking:

    • Co-immunoprecipitation assays to assess subunit interactions

    • FACS analysis with subunit-specific antibodies

    • Confocal microscopy with fluorescently-tagged subunits

    • Brefeldin A treatment to block protein transport from ER to Golgi

The complete molecular complex typically includes CACNA1S (α1), CACNA2D2 (α2δ2), and CACNB3 (β3) subunits, though variant compositions occur in different tissues and developmental stages .

What is the relationship between chicken CACNA1S and immune responses to pathogens?

Emerging research suggests CACNA1S plays substantial roles in chicken immune responses to pathogens. The evidence indicates multiple mechanisms:

  • Pathogen resistance correlation: Genetic studies identified significant associations between CACNA1S variants and survival rates following S. pullorum challenge. Specifically, mutations in CACNA1S exons correlate with altered susceptibility/resistance to pullorum disease .

  • Calcium signaling in immune cells: CACNA1S-mediated calcium influx likely modulates:

    • Pattern recognition receptor signaling

    • NF-κB pathway activation

    • Inflammatory cytokine production

    • Adaptive immune responses

  • Cross-species evidence: Studies in mammalian models show that CACNA1S deficiency confers resistance to certain viral infections, suggesting evolutionarily conserved immune functions. In mouse models, CACNA1S knockout resulted in resistance to New World Arenavirus infection .

  • Potential mechanisms: CACNA1S may influence:

    • Pathogen entry into host cells

    • Inflammatory responses during infection

    • Cell survival during infection

    • Bacterial clearance mechanisms

Experimental data shows that bacterial loads in organs of chickens with different CACNA1S variants differ significantly after S. pullorum challenge. Specifically, the liver bacterial load of dead chickens with variant CACNA1S was significantly higher than those with wildtype CACNA1S (p < 0.01) , suggesting altered immune clearance mechanisms.

What methodological approaches can resolve contradictory findings about CACNA1S function?

When facing contradictory findings about chicken CACNA1S function, researchers should implement the following methodological approaches:

  • Standardized experimental systems:

    • Use genetically defined chicken lines

    • Standardize cell isolation and culture conditions

    • Implement consistent challenge protocols (e.g., S. pullorum at 6.3 × 10^6 CFU)

    • Control for environmental variables

  • Multi-omics integration:

    • Combine genomics, transcriptomics, and proteomics

    • Correlate genotype with phenotype across multiple levels

    • Include epigenetic analyses to capture regulatory mechanisms

  • Tissue-specific analyses:

    • Separate analyses by tissue type (muscle, heart, immune cells)

    • Consider developmental stage effects

    • Examine CACNA1S function in context of the microenvironment

  • Experimental validation across models:

    • Primary cells vs. cell lines

    • Ex vivo vs. in vivo models

    • Cross-species validation where appropriate

  • Statistical rigor:

    • Appropriate sample sizes based on power calculations

    • Multiple testing correction in genetic association studies

    • Replication in independent populations

    • Blind analysis when possible

For example, contradictions between gene expression and genetic association studies may be resolved by examining both transcript levels and protein function, as post-translational modifications significantly impact CACNA1S activity. Additionally, considering maternal antibody effects is crucial, as positive offspring chicks may receive vertically transmitted maternal antibodies to S. pullorum, affecting experimental outcomes .

What controls are essential when studying recombinant chicken CACNA1S function?

When designing experiments to study recombinant chicken CACNA1S function, the following controls are essential:

  • Expression controls:

    • Empty vector transfection to control for transfection effects

    • Wild-type CACNA1S expression alongside mutant variants

    • Co-expression of all necessary channel subunits (CACNA2D2, CACNB3) to ensure proper complex formation

    • Verification of protein expression via Western blot and surface expression via FACS

  • Functional controls:

    • Known channel modulators (agonists/antagonists) to confirm channel activity

    • Calcium channel blockers as negative controls

    • Measurement of endogenous calcium channel activity in experimental cells

    • Positive controls with established electrophysiological properties

  • Genetic controls:

    • Heterozygous (+/-) models alongside homozygous knockouts to assess gene dosage effects

    • Rescue experiments with wild-type CACNA1S in knockout backgrounds

    • Isogenic cell lines differing only in CACNA1S status

  • Infection model controls:

    • Uninfected controls for baseline comparisons

    • Varying bacterial/viral doses to establish dose-response relationships

    • Time-course experiments to capture dynamic responses

    • Measurement of bacterial loads in multiple tissues to assess systemic effects

Notably, in knockout studies of CACNA1S, researchers should verify multiple aspects of the knockout phenotype, including RNA levels, protein expression, and surface expression of both CACNA1S and its partner subunits like CACNA2D2 .

How can researchers optimize recombinant chicken CACNA1S expression for functional studies?

Optimizing recombinant chicken CACNA1S expression requires attention to several critical factors:

  • Vector selection and design:

    • Use strong promoters appropriate for target cells (CMV for mammalian cells)

    • Include Kozak sequence for efficient translation initiation

    • Consider adding epitope tags (FLAG, V5) for detection without interfering with function

    • Optimize codon usage for the expression system

  • Co-expression strategy:

    • Always co-express auxiliary subunits (CACNB3, CACNA2D2) for proper trafficking and function

    • Optimize subunit ratios (typically 1:1:1 for α1:α2δ:β)

    • Consider using bicistronic vectors to ensure co-expression in the same cells

  • Cell system optimization:

    • HEK293T cells provide good expression for initial characterization

    • Chicken cell lines offer more physiologically relevant environment

    • Control cell density (70-80% confluency optimal for transfection)

    • Minimize passage number to avoid phenotypic drift

  • Transfection protocol refinement:

    • Lipofectamine 3000 shows good efficiency for CACNA1S expression

    • Optimize DNA:lipid ratios (typically 1:3)

    • Allow 48-72 hours for expression before functional assays

    • Consider stable cell line generation for consistent expression

  • Verification methods:

    • RT-qPCR for mRNA expression

    • Western blot for total protein

    • FACS for surface expression using conjugated antibodies (CACNA1S(1A)-Alexa Fluor 647)

    • Patch-clamp electrophysiology to confirm functional expression

For maximum expression efficiency, researchers should implement a stepwise optimization approach, testing multiple conditions in parallel and selecting the best performers for subsequent experiments.

What are the most sensitive methods for detecting chicken CACNA1S protein-protein interactions?

For detecting and characterizing chicken CACNA1S protein-protein interactions, researchers should consider these sensitive methodologies:

  • Co-immunoprecipitation (Co-IP):

    • Utilize epitope-tagged constructs (FLAG, V5) for specific pull-down

    • Cross-link proteins prior to lysis for transient interactions

    • Use physiological buffers to maintain native interactions

    • Confirm with reverse Co-IP (pull down partner and detect CACNA1S)

  • Proximity Ligation Assay (PLA):

    • Enables visualization of protein interactions in situ

    • Requires specific antibodies against CACNA1S and partner proteins

    • Provides spatial information about interaction sites

    • Allows quantification of interaction signals

  • FRET/BRET approaches:

    • Fuse fluorescent/bioluminescent proteins to CACNA1S and potential partners

    • Measure energy transfer as indicator of proximity

    • Can detect dynamic changes in protein interactions

    • Works in living cells under physiological conditions

  • Surface Plasmon Resonance (SPR):

    • Requires purified recombinant proteins

    • Provides binding kinetics and affinity measurements

    • Can detect weak or transient interactions

    • Allows testing of interaction modulators

  • Protein complementation assays:

    • Split-YFP or split-luciferase fused to potential interaction partners

    • Signal generated only when proteins interact

    • Can be used in living cells

    • Suitable for high-throughput screening

When studying CACNA1S interactions with other calcium channel subunits, researchers have successfully employed co-transfection of tagged constructs followed by co-immunoprecipitation and western blotting . For surface expression analysis, FACS with subunit-specific antibodies has proven effective for detecting assembled complexes at the plasma membrane .

How should researchers interpret contradictory data between in vitro and in vivo studies of chicken CACNA1S?

When facing contradictions between in vitro and in vivo findings on chicken CACNA1S, researchers should implement this interpretive framework:

  • Systematic comparison of experimental conditions:

    • Analyze differences in CACNA1S expression levels between systems

    • Compare auxiliary subunit composition and ratios

    • Evaluate presence of regulatory proteins in different systems

    • Consider temporal dynamics of observations

  • Biological context considerations:

    • In vitro systems lack the complexity of physiological environments

    • Immune responses in vivo involve multiple cell types and signaling pathways

    • Maternal antibodies may affect in vivo outcomes (observed in S. pullorum studies)

    • Compensatory mechanisms may exist in whole organisms but not cell cultures

  • Technical limitations assessment:

    • Cell culture conditions may alter channel properties

    • Recombinant expression levels typically exceed physiological levels

    • In vivo measurements often have higher variability

    • Analytical techniques may have different sensitivities across systems

  • Contextual interpretation framework:

    • In vitro studies best inform molecular mechanisms and direct interactions

    • In vivo studies better represent physiological relevance and systems-level outcomes

    • Both approaches provide complementary rather than contradictory insights

    • Develop integrated models that accommodate findings from both contexts

For example, when S. pullorum challenge studies showed differences between positive and negative offspring chicks, researchers attributed this to maternal antibodies affecting the secondary immune response in vivo , a factor absent in isolated cell systems.

What statistical approaches are most appropriate for analyzing chicken CACNA1S genetic variation data?

For robust analysis of chicken CACNA1S genetic variation data, researchers should employ these statistical methodologies:

  • Genome-wide association studies (GWAS):

    • Implement mixed linear models to account for population structure

    • Apply appropriate multiple testing correction (Bonferroni or FDR)

    • Consider haplotype-based approaches for greater power

    • Validate findings in independent populations

  • Variant effect analysis:

    • Distinguish between synonymous and non-synonymous mutations

    • Apply prediction algorithms (SIFT, PolyPhen) for functional impact

    • Consider evolutionary conservation at variant sites

    • Classify variants by domain location within CACNA1S protein

  • Genotype-phenotype correlations:

    • Use survival analysis for disease challenge studies

    • Implement case-control comparisons with matched controls

    • Consider quantitative trait analysis for continuous phenotypes

    • Account for environmental and maternal factors

  • Population genetics approaches:

    • Calculate fixation indices (FST) to identify selection signatures

    • Analyze linkage disequilibrium patterns around CACNA1S

    • Consider demographic history in interpretation

    • Test for Hardy-Weinberg equilibrium at variant sites

In one study, researchers successfully identified 195 SNPs and 79 significant InDels associated with S. pullorum susceptibility/resistance using whole-genome association analysis. Among these, variants in CACNA1S exons were highlighted as particularly relevant to disease outcomes .

How can researchers distinguish direct effects of CACNA1S from indirect consequences?

Distinguishing direct CACNA1S effects from indirect consequences requires methodical experimental design:

  • Temporal analysis:

    • Implement time-course experiments to establish sequence of events

    • Use rapid manipulation techniques (optogenetics, caged compounds)

    • Monitor calcium dynamics in real-time following channel activation/inhibition

    • Compare kinetics of different downstream processes

  • Gain/loss of function approaches:

    • Generate channel mutants with specific functional deficits

    • Use site-directed mutagenesis to target specific domains

    • Create chimeric channels to isolate functional regions

    • Implement graded knockdown approaches to establish dose-dependency

  • Pathway dissection:

    • Use specific inhibitors of downstream signaling components

    • Implement parallel knockdown of CACNA1S and potential mediators

    • Monitor calcium-dependent and calcium-independent pathways separately

    • Employ pathway reconstruction in simplified systems

  • Proximity-based methods:

    • Utilize FRET sensors for calcium in subcellular compartments

    • Implement proximity labeling (BioID, APEX) to identify direct interactors

    • Use calcium uncaging to bypass channel function

    • Apply super-resolution microscopy to resolve spatial relationships

For example, when studying CACNA1S in pathogen resistance, researchers should distinguish between:

  • Direct effects on pathogen entry and replication

  • Indirect effects via immune signaling pathways

  • Secondary consequences of altered physiology (e.g., cardiac effects)

These approaches can help determine whether CACNA1S directly affects S. pullorum susceptibility or operates through intermediate mechanisms.

How might chicken CACNA1S variants be utilized for selective breeding to enhance disease resistance?

The potential of chicken CACNA1S variants for selective breeding programs to enhance disease resistance follows these strategic approaches:

Research has revealed that specific CACNA1S variants may confer resistance to S. pullorum, potentially through altered immune responses or pathogen interactions . The non-synonymous mutations identified in CACNA1S exons are particularly promising targets for selection programs.

What novel experimental approaches could advance understanding of chicken CACNA1S function?

Advancing our understanding of chicken CACNA1S function requires innovative experimental approaches:

  • Advanced genetic engineering:

    • CRISPR/Cas9 knock-in of specific SNPs identified in resistant chicken populations

    • Base editing to introduce precise mutations without double-strand breaks

    • Conditional knockout systems to study tissue-specific effects

    • Inducible expression systems to control timing of CACNA1S function

  • Single-cell technologies:

    • Single-cell RNA-seq to identify cell populations dependent on CACNA1S

    • Mass cytometry to correlate CACNA1S expression with cellular phenotypes

    • Patch-seq to link electrophysiological properties with transcriptional profiles

    • Spatial transcriptomics to map CACNA1S expression in tissue contexts

  • Advanced imaging approaches:

    • Genetically-encoded calcium indicators targeted to specific cellular compartments

    • Super-resolution microscopy of CACNA1S complexes

    • Intravital imaging to track calcium dynamics in living tissues

    • Correlative light and electron microscopy to link function with ultrastructure

  • Systems biology integration:

    • Multi-omics integration across genomics, transcriptomics, proteomics

    • Network analysis of CACNA1S interactors

    • Mathematical modeling of calcium dynamics in different cell types

    • Machine learning approaches to predict functional outcomes of CACNA1S variants

These approaches would significantly enhance our ability to understand how specific CACNA1S variants contribute to disease resistance mechanisms, particularly in the context of S. pullorum infection where CACNA1S has been identified as a potential resistance gene .

How does chicken CACNA1S interact with the gut microbiome in health and disease?

The interaction between chicken CACNA1S and the gut microbiome represents an emerging research area with significant implications:

  • Observed associations:

    • Studies have shown that S. pullorum infection causes significant changes in gut microbiota diversity and community structure

    • CACNA1S genetic variants are associated with susceptibility/resistance to S. pullorum infection

    • These relationships suggest potential CACNA1S-microbiome interaction pathways

  • Potential mechanisms:

    • CACNA1S may influence intestinal motility, affecting microbial transit time

    • Calcium signaling modulates intestinal epithelial barrier function

    • CACNA1S-mediated immune responses may shape microbial communities

    • Microbial metabolites might reciprocally regulate CACNA1S expression or function

  • Key microbial players:

    • Lactobacillus, Escherichia_Shigella, and Klebsiella were identified as dominant bacteria in susceptible chickens

    • These bacteria showed significantly higher abundance in dead negative offspring chicks compared to survivors

    • This suggests specific microbial signatures associated with CACNA1S-related disease outcomes

  • Research approaches:

    • Gnotobiotic studies with defined microbial communities

    • Longitudinal sampling before and after pathogen challenge

    • Metabolomic analysis to identify microbial products affecting CACNA1S function

    • Co-culture systems to study direct microbe-host cell interactions

Understanding this relationship could lead to novel intervention strategies combining genetic selection for beneficial CACNA1S variants with microbiome modulation approaches to enhance chicken health and disease resistance.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.