Recombinant Chicken Voltage-dependent P/Q-type calcium channel subunit alpha-1A (CACNA1A)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization and Structure

The Voltage-dependent P/Q-type calcium channel subunit alpha-1A (CACNA1A) in chickens is a membrane-bound protein identified by UniProt code O73705, with alternative nomenclature including CHCACHA1A and Voltage-gated calcium channel subunit alpha Cav2.1 . This protein has a molecular weight of approximately 19,657 Da and functions as a multi-pass membrane protein embedded within the cell membrane .

Voltage-dependent calcium channels are complex structures composed of multiple subunits arranged in a specific configuration. These channels exist as multisubunit complexes consisting of alpha-1, alpha-2, beta, and delta subunits in a precise 1:1:1:1 ratio . Within this complex architecture, CACNA1A serves as the critical alpha-1A subunit, which forms the central pore of the channel and contains the voltage-sensing domains necessary for channel activation .

The alpha-1A subunit represents the primary functional component of the channel, as it is both pore-forming and voltage-sensitive . While the alpha-1A subunit can often generate voltage-sensitive calcium channel activity independently, the auxiliary subunits—particularly the beta subunit and the alpha-2/delta complex linked by disulfide bridges—provide important regulatory functions that modulate channel properties including activation kinetics, inactivation rates, and membrane trafficking .

Calcium Channel Classification and Electrophysiology

The chicken CACNA1A protein specifically gives rise to P/Q-type calcium currents within the cellular environment . These P/Q-type calcium channels belong to the "high-voltage activated" (HVA) group of calcium channels, indicating they require substantial membrane depolarization to transition to their open state . This electrophysiological classification distinguishes them from low-voltage activated channels that respond to smaller membrane potential changes.

A defining pharmacological characteristic of P/Q-type calcium channels is their selective sensitivity to specific toxins. These channels are specifically blocked by the spider toxin omega-agatoxin-IVA, which provides a valuable tool for their identification and functional isolation in experimental settings . Conversely, they demonstrate insensitivity to dihydropyridines (DHPs), a property that distinguishes them from L-type calcium channels .

Physiological Significance

Voltage-dependent calcium channels mediate the controlled entry of calcium ions into excitable cells, serving as gatekeepers for this critical signaling ion . The resultant calcium influx participates in numerous calcium-dependent processes, including:

  • Muscle contraction regulation

  • Hormone and neurotransmitter release

  • Gene expression modulation

  • Cell motility

  • Cell division processes

  • Cell death pathways

Research Tools and Detection Methods

Comparative Analysis with Human CACNA1A

While specific comparative data between chicken and human CACNA1A is limited in the available research, several functional similarities suggest evolutionary conservation of this important channel protein. The human CACNA1A gene encodes the pore-forming subunit of voltage-gated P/Q-type calcium channels similar to its chicken counterpart . In humans, CACNA1A is widely distributed throughout neuronal tissues and has been identified as a therapeutic target in the treatment of inflammatory pain conditions .

Human CACNA1A has been extensively studied due to its association with several neurological disorders, including Spinocerebellar Ataxia 6, episodic ataxia type 2, and familial hemiplegic migraine . These associations highlight the critical nature of proper calcium channel function for neurological health and provide important context for comparative studies using chicken CACNA1A.

Research Applications and Future Directions

Recombinant chicken CACNA1A serves as a valuable model system for investigating fundamental aspects of calcium channel biology. Researchers employ various tools including ELISA kits for detection and cell-based systems for functional studies. While the search results specifically mention human CACNA1A/CACNB4/CACNA2D1 stable cell lines in CHO cells , similar approaches could potentially be applied to chicken CACNA1A for comparative studies.

The specificity of available detection methods extends to both natural and recombinant forms of chicken CACNA1A , facilitating various research applications including:

  • Investigating calcium channel expression patterns across different tissues

  • Studying developmental regulation of calcium channels

  • Exploring functional consequences of CACNA1A mutations or modifications

  • Screening compounds that modulate channel activity

  • Examining interspecies differences in calcium channel properties

Future research directions may explore the three-dimensional structure of chicken CACNA1A, its specific interactions with regulatory proteins, and the development of targeted modulators that could have therapeutic relevance across species.

Sample Preparation and Handling

For optimal results when working with recombinant chicken CACNA1A, careful attention to sample preparation is essential. The protein can be detected in various biological samples including serum, plasma, tissue homogenates, and cell culture supernatants . Each sample type may require specific handling protocols to ensure protein stability and assay compatibility.

When working with ELISA-based detection methods, samples should be collected using standard procedures that minimize protein degradation. This typically involves the use of protease inhibitors, maintenance of cold temperatures during processing, and avoidance of repeated freeze-thaw cycles. Proper sample dilution is also critical for ensuring measurements fall within the linear range of the assay.

Quality Control and Validation

Quality control measures are essential when working with recombinant chicken CACNA1A. Commercial ELISA kits typically undergo rigorous validation to ensure specificity for the target protein. This validation includes confirmation that the assay detects both natural and recombinant forms of chicken CACNA1A with high specificity .

For researchers producing recombinant chicken CACNA1A in laboratory settings, validation steps should include:

  • Verification of protein identity through mass spectrometry or immunoblotting

  • Assessment of protein purity using gel electrophoresis techniques

  • Functional validation through electrophysiological methods

  • Comparison with native protein when possible

These quality control measures help ensure experimental reliability and facilitate accurate interpretation of research findings.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
CACNA1A; Voltage-dependent P/Q-type calcium channel subunit alpha-1A; CHCACHA1A; Voltage-gated calcium channel subunit alpha Cav2.1; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-171
Protein Length
Full length protein
Species
Gallus gallus (Chicken)
Target Names
Target Protein Sequence
FVTVLGSITDILVTEFGNNFINLSFLRLFRAARLIKLLRQGYTIRILLWTFVQSFKALPY VCLLIAMLFFIYAIIGMQVFGNIGIEEEDDESAITQHNNFRTFFQALMLLFRSATGEAWH EIMLSCLSGKPCDENSGIKEDECGNEFAYFYFVSFIFLCSFLMLNLFVAVI
Uniprot No.

Target Background

Function

The alpha-1A isoform generates P and/or Q-type calcium currents. P/Q-type calcium channels are classified as high-voltage-activated (HVA) channels.

Database Links

UniGene: Gga.527

Protein Families
Calcium channel alpha-1 subunit (TC 1.A.1.11) family, CACNA1A subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is CACNA1A and what is its primary function in avian neural physiology?

CACNA1A encodes the alpha-1A subunit of voltage-sensitive calcium channels (VSCC), which mediate calcium ion entry into excitable cells. This protein forms the pore-forming component of P/Q-type calcium channels, primarily expressed in neuronal tissue. In avian systems, as in mammals, these channels belong to the high-voltage activated (HVA) group and are specifically blocked by spider omega-agatoxin-IVA while remaining insensitive to dihydropyridines .

The primary functions of CACNA1A in avian neural physiology include:

  • Regulating neurotransmitter release at presynaptic terminals

  • Mediating calcium-dependent cellular processes including gene expression

  • Contributing to neuronal excitability and firing patterns

  • Facilitating cellular signaling in various neural circuits

Unlike other calcium channels, P/Q-type channels display distinct electrophysiological properties that make them particularly important in precise timing of neurotransmitter release at specific synapses in the avian brain.

How does the structural organization of chicken CACNA1A compare to mammalian orthologs?

Chicken CACNA1A shares significant structural homology with mammalian orthologs, particularly in the pore-forming regions and voltage-sensing domains. The protein contains four homologous domains (I-IV), each with six transmembrane segments (S1-S6) where the S4 segments serve as voltage sensors and the loops between S5 and S6 form the channel pore .

While highly conserved in functional domains, species-specific variations exist in:

  • N-terminal and C-terminal regions

  • Cytoplasmic linking loops between domains

  • Specific amino acid residues within functional domains that may influence channel kinetics

  • Regulatory sites for phosphorylation and protein-protein interactions

These structural differences may account for species-specific channel properties that could be advantageous for certain experimental paradigms when using chicken CACNA1A compared to mammalian versions.

What are the known functional domains of CACNA1A and their significance in experimental design?

CACNA1A contains several critical functional domains that should be considered when designing experiments:

  • Voltage-sensing domains (S4 segments): Contain positively charged residues that respond to membrane potential changes

  • Pore-forming regions (S5-S6 loops): Determine ion selectivity and conductance properties

  • AID (Alpha Interaction Domain): Mediates binding with beta subunits, affecting channel trafficking and kinetics

  • EF-hand motifs: Potential calcium-binding regions involved in calcium-dependent inactivation

  • IQ-like motif: Interacts with calmodulin, modulating channel function

When designing recombinant constructs, researchers should preserve these domains' integrity to maintain native channel function. Targeted mutations within these regions can provide valuable insights into structure-function relationships but may also compromise protein expression or trafficking if critical residues are altered.

What expression systems are optimal for producing functional recombinant chicken CACNA1A?

Expressing functional recombinant chicken CACNA1A presents significant challenges due to its large size (~250 kDa) and complex multi-domain structure. Several expression systems have been used with varying degrees of success:

Mammalian Cell Lines:

  • HEK293 cells provide a superior environment for proper folding and post-translational modifications

  • COS-7 cells offer good expression levels but slightly lower functionality

  • Neuro2A cells provide a more neuron-like environment that may support native channel assembly

Advantages of Xenopus oocytes:

  • Robust translation machinery capable of handling large proteins

  • Well-established for electrophysiological recordings

  • Lower expression temperatures (16-18°C) that favor proper folding of complex proteins

For optimal functional expression, co-expression with auxiliary subunits (β and α2δ) is essential, as these significantly enhance surface expression and recapitulate native channel properties .

What methodologies are most effective for confirming proper expression and function of recombinant CACNA1A?

Multiple complementary approaches should be employed to verify both expression and functionality:

Protein Expression Confirmation:

  • Western blotting with domain-specific antibodies

  • Immunocytochemistry to assess cellular localization

  • FACS analysis if using fluorescent protein tags

Functional Assessment:

  • Patch-clamp electrophysiology remains the gold standard for functional characterization

  • Calcium imaging using fluorescent indicators (Fura-2, Fluo-4)

  • Radioligand binding assays using labeled omega-agatoxin-IVA

When conducting electrophysiological studies, characteristic P/Q-type currents should display:

  • High voltage activation thresholds (typically >-20mV)

  • Sensitivity to omega-agatoxin-IVA (specific blocker)

  • Insensitivity to dihydropyridines and omega-conotoxin GVIA (L-type and N-type blockers, respectively)

How can researchers optimize purification of recombinant chicken CACNA1A for structural studies?

Purification of full-length CACNA1A presents substantial challenges due to its size, hydrophobicity, and complex structure. A methodical approach includes:

Solubilization Strategy:

  • Test multiple detergents (DDM, LMNG, GDN) at various concentrations

  • Consider amphipol-based approaches for enhanced stability

  • Implement mild solubilization conditions to preserve protein-protein interactions with auxiliary subunits

Affinity Purification:

  • Engineer dual tags (e.g., His8 and FLAG) for tandem purification

  • Position tags carefully to avoid interference with functional domains

  • Consider using a protease-resistant core construct for structural studies

Quality Control:

  • Size-exclusion chromatography to assess homogeneity and aggregation state

  • Negative-stain electron microscopy for initial structural assessment

  • Thermal stability assays to optimize buffer conditions

For cryogenic electron microscopy studies, preparation of CACNA1A in nanodiscs or other membrane mimetics has proven more successful than detergent-solubilized preparations in maintaining native-like conformations.

What approaches can be used to study the pharmacological properties of chicken CACNA1A compared to mammalian orthologs?

Comparative pharmacological profiling between chicken and mammalian CACNA1A can provide valuable insights into structural determinants of drug binding and species-specific responses. Recommended approaches include:

Systematic Pharmacological Profiling:

  • Dose-response relationships for omega-agatoxin-IVA and related peptide toxins

  • Sensitivity to small-molecule modulators

  • Response to divalent and trivalent cations (Cd²⁺, La³⁺) that differentially block calcium channels

Experimental Design Considerations:

  • Maintain consistent recording conditions (temperature, ionic composition, holding potentials)

  • Use standardized voltage protocols to activate and inactivate channels

  • Implement rapid perfusion systems for accurate drug application and washout

Data Analysis Framework:

  • Fit dose-response curves using appropriate models (Hill equation, logistic functions)

  • Calculate IC₅₀/EC₅₀ values with confidence intervals

  • Perform kinetic analysis of block/unblock rates

Species differences in pharmacological profiles can provide insights into evolutionary adaptation and may identify binding sites that could be targeted for species-selective modulators .

How should researchers design electrophysiological protocols to fully characterize chicken CACNA1A properties?

Comprehensive electrophysiological characterization requires systematic investigation of multiple channel properties:

Activation Protocols:

  • I-V relationships using step depolarizations from −80 mV to +60 mV

  • Tail current protocols for determining activation parameters

  • Action potential waveforms to assess behavior under physiological conditions

Inactivation Assessment:

  • Steady-state inactivation using pre-pulse protocols

  • Recovery from inactivation at various holding potentials

  • Cumulative inactivation during repetitive stimulation

Modulation Studies:

  • G-protein modulation using GTPγS or activation of G-protein coupled receptors

  • Calcium-dependent facilitation and inactivation

  • Phosphorylation effects using kinase activators/inhibitors

Data Table: Essential Voltage Protocols for CACNA1A Characterization

Protocol TypeVoltage RangeHolding PotentialInter-Sweep IntervalPurpose
I-V Relationship-80 to +60 mV (10 mV steps)-90 mV10-15 secondsActivation threshold and peak current voltage
Steady-state Inactivation-120 to +10 mV pre-pulses-90 mV15-20 secondsAvailability curve (h∞)
Tail CurrentsStep to +20 mV, repolarize to -120 to 0 mV-90 mV10-15 secondsDeactivation kinetics
Recovery from InactivationPaired pulses with variable interval-90 mV30 secondsRecovery time constants

Analysis should include both steady-state properties and kinetic parameters to fully describe channel behavior under various conditions .

What experimental approaches can address the role of auxiliary subunits in modulating chicken CACNA1A function?

Auxiliary subunits significantly impact CACNA1A trafficking, gating properties, and pharmacology. Systematic investigation requires:

Reconstitution Studies:

  • Co-expression of CACNA1A with different β subunit isoforms (β1-4)

  • Examination of α2δ subunit effects on surface expression and current density

  • Assessment of γ subunit modulation (though less well characterized)

Molecular Approaches:

  • Site-directed mutagenesis of interaction domains

  • Creation of chimeric constructs between species to identify critical regions

  • FRET/BRET studies to examine protein-protein interactions in live cells

Functional Readouts:

  • Shifts in voltage-dependent activation/inactivation

  • Changes in kinetic parameters (activation, inactivation, recovery)

  • Alterations in drug sensitivity

Particular attention should be paid to the Alpha Interaction Domain (AID) in the I-II linker region, which is the primary site of β subunit binding and highly conserved across species .

How can recombinant chicken CACNA1A be used to model human channelopathies?

Human CACNA1A mutations cause several neurological disorders including episodic ataxia type 2 (EA2), familial hemiplegic migraine type 1 (FHM1), and spinocerebellar ataxia type 6 (SCA6). Chicken CACNA1A provides an alternative model system with several advantages:

Cross-Species Disease Modeling:

  • Introduction of corresponding human disease mutations into chicken CACNA1A

  • Comparison of functional effects to identify conserved pathological mechanisms

  • Assessment of species-specific compensatory mechanisms

Experimental Advantages:

  • Chicken neurons can be more readily cultured than mammalian counterparts

  • Certain mutations may show enhanced expression in avian systems

  • The slightly different protein architecture may reveal unique insights into structure-function relationships

Methodological Approach:

  • Identify equivalent residues in chicken CACNA1A that correspond to human disease mutations

  • Generate mutant constructs using site-directed mutagenesis

  • Express in heterologous systems alongside wild-type chicken and human CACNA1A

  • Compare biophysical and pharmacological properties

For example, the Tottering mutation in mice (corresponding to P601L in humans) causes absence epilepsy phenotypes that could be investigated in the chicken ortholog to examine if the pathophysiological mechanisms are conserved across species .

What insights from mouse CACNA1A knockout models are applicable to research with chicken CACNA1A?

Studies in mouse knockout models provide valuable reference points for researchers working with chicken CACNA1A:

Phenotypic Comparisons:
Mouse models with Cacna1a deletion display ataxia, absence epilepsy, and dystonia, closely resembling human CACNA1A-associated disorders. These phenotypes emerge due to specific changes in neural circuitry that likely have parallels in avian systems .

Circuit-Specific Effects:
In mice, loss of P/Q-type channels in thalamocortical circuits leads to spike-wave discharges characteristic of absence epilepsy. The specific compensatory changes in thalamic neurons, including alterations in T-type calcium channel expression, provide hypotheses that can be tested in chicken models .

Developmental Considerations:
Interestingly, adult-onset deletion of Cacna1a in mice produces similar phenotypes to germline deletion, indicating that many CACNA1A-related phenotypes don't require developmental abnormalities. This suggests that acute manipulation of chicken CACNA1A (e.g., through viral transduction or pharmacological approaches) could produce informative phenotypes for study .

What technical approaches can resolve contradictory findings between species in CACNA1A research?

Contradictory findings across species are common in ion channel research and require systematic investigation:

Source Validation:

  • Verify sequence integrity of all constructs

  • Confirm expression levels are comparable across experimental systems

  • Ensure auxiliary subunit composition is matched between comparisons

Methodological Standardization:

  • Use identical recording solutions and experimental conditions

  • Implement consistent analysis parameters for kinetic measurements

  • Employ dual recording systems to eliminate setup-specific artifacts

Targeted Mutagenesis Approach:

  • Create chimeric channels between species to localize regions responsible for functional differences

  • Perform systematic point mutations of non-conserved residues

  • Use computational modeling to predict functional consequences of sequence variations

Data Table: Common Sources of Cross-Species Discrepancies in CACNA1A Studies

FactorImpactResolution Strategy
Recording TemperatureAlters kinetics, particularly inactivationConduct experiments at both room temperature and physiological temperature
Auxiliary Subunit CompositionChanges surface expression and gatingSystematically co-express with matched subunit sets
Alternative SplicingCreates functionally distinct isoformsSequence verification and isoform-specific primers
Post-translational ModificationsAlters channel properties based on cellular contextUse phosphatase/kinase inhibitors; mass spectrometry verification
Expression Level VariationsCan affect measured parameters due to current densityTitrate expression levels; normalize to capacitance

By systematically addressing these factors, researchers can distinguish genuine species differences from technical artifacts .

How can genome editing techniques be optimized for studying chicken CACNA1A in primary neuronal cultures?

CRISPR-Cas9 and related genome editing technologies offer powerful approaches for studying CACNA1A function in chicken neurons:

Design Considerations:

  • Select guide RNAs with high specificity for chicken CACNA1A

  • Target conserved exons to ensure functional disruption

  • Consider knock-in strategies for introducing reporter tags or human mutations

Delivery Optimization:

  • For chicken embryonic neurons, electroporation often provides superior efficiency

  • Lentiviral vectors allow for stable expression in longer-term cultures

  • Nucleofection can be effective for post-mitotic neurons

Validation Approaches:

  • Design PCR strategies to confirm genomic modifications

  • Implement Western blotting to verify protein expression changes

  • Conduct electrophysiological recording to confirm functional effects

For creating isogenic lines with specific mutations, base editing or prime editing technologies may offer advantages over traditional homology-directed repair, particularly for introducing point mutations that mimic human disease variants.

What computational modeling approaches are most valuable for predicting structural changes in mutant CACNA1A channels?

Computational modeling provides valuable insights into CACNA1A structure-function relationships:

Homology Modeling:

  • Use cryo-EM structures of related calcium channels as templates

  • Refine models with molecular dynamics simulations

  • Validate predictions with mutagenesis experiments

Molecular Dynamics Simulations:

  • Simulate channel behavior in explicit lipid bilayers

  • Predict conformational changes during gating transitions

  • Model ion permeation and selectivity

Machine Learning Applications:

  • Predict functional impacts of novel variants

  • Identify critical residues for specific channel properties

  • Develop structure-based pharmacophore models for drug discovery

When implementing these approaches, researchers should be aware of limitations, particularly the challenges in accurately modeling the large intracellular loops and terminal regions that lack resolved structures in template proteins .

How can single-molecule approaches advance our understanding of CACNA1A conformational dynamics?

Single-molecule techniques provide unique insights into CACNA1A function that are obscured in ensemble measurements:

Single-Molecule FRET:

  • Place fluorescent probes at strategic locations to monitor conformational changes

  • Track real-time movements during channel activation and inactivation

  • Identify intermediate states not resolved by electrophysiology

Methodological Implementation:

  • Engineer CACNA1A constructs with minimal labeling sites at functionally important regions

  • Verify that labeled constructs retain normal function

  • Perform FRET measurements under various conditions (voltage, calcium concentration)

  • Correlate FRET signals with functional states determined by electrophysiology

Technical Challenges:

  • Large size of CACNA1A complicates labeling strategy

  • Membrane environment creates background fluorescence challenges

  • Low expression levels limit signal-to-noise ratio

Despite these challenges, single-molecule approaches offer unprecedented resolution of conformational dynamics that complement traditional electrophysiological methods.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.