Recombinant Chicken Zinc transporter 7 (SLC30A7)

Shipped with Ice Packs
In Stock

Description

Protein Identification and Nomenclature

Recombinant Chicken Zinc transporter 7 belongs to the solute carrier family 30 (SLC30), specifically member 7, commonly known as SLC30A7 or ZNT7. This protein is identified by the UniProt ID Q5MNV6 and is classified within the zinc transporter family that regulates zinc ion movement across cellular compartments . The protein carries multiple designations in scientific literature and commercial products, including zinc transporter 7 and solute carrier family 30 member 7, highlighting its functional role in zinc transport mechanisms .

Comparative Analysis with Other Species

While the focus of this article is specifically on chicken SLC30A7, understanding its evolutionary relationships with other species provides valuable context. The structural conservation of SLC30A7 across species suggests its fundamental importance in cellular zinc homeostasis. Human ZnT7 (hZnT7), a homolog of chicken SLC30A7, has been shown to localize in the Golgi membrane and transport zinc from the cytosol into the Golgi lumen . This function is likely conserved in the chicken protein as well, making it an excellent model for studying zinc transport mechanisms.

Expression Systems and Tags

The recombinant chicken SLC30A7 protein is typically produced using bacterial expression systems, most commonly Escherichia coli (E. coli) . The full-length protein (amino acids 1-378) is engineered with an N-terminal histidine (His) tag, which facilitates protein purification through affinity chromatography methods . This recombinant design ensures efficient production and isolation of the protein while minimizing interference with its structural and functional properties.

Physical Properties and Purity

The commercially available recombinant chicken SLC30A7 protein is typically supplied as a lyophilized powder, which ensures stability during storage and shipping . Quality control measures indicate that the protein reaches a purity greater than 90% as determined by sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE) . Alternative preparations may achieve a purity of at least 85% as assessed by the same method .

Table 1: Technical Specifications of Recombinant Chicken SLC30A7 Protein

ParameterSpecification
Catalog NumberRFL27634GF
SpeciesChicken
Expression SystemE. coli
TagN-terminal His
Protein LengthFull Length (1-378 amino acids)
Physical FormLyophilized powder
Purity>90% (SDS-PAGE)
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
UniProt IDQ5MNV6

Physiological Significance and Disease Implications

Research on SLC30A7/ZnT7 across species has revealed its importance in multiple physiological processes. Studies in mouse models have shown that genetic deficiency of SLC30A7 can lead to mild zinc deficiency and increased susceptibility to developing prostate cancer and insulin resistance . Additionally, biallelic variants in human SLC30A7 have been associated with growth retardation, testicular hypoplasia, and various syndromic conditions .

These findings highlight the critical role of SLC30A7 in maintaining proper zinc homeostasis and suggest that the chicken ortholog likely plays similar important roles in avian physiology. The recombinant chicken SLC30A7 protein therefore serves as a valuable research tool for investigating zinc transport mechanisms and their implications for health and disease.

Research Applications

Recombinant chicken SLC30A7 protein has several potential applications in scientific research:

  1. Structural studies: The purified protein can be used for crystallographic or cryo-EM studies to determine the three-dimensional structure of avian zinc transporters.

  2. Antibody production: The recombinant protein can serve as an antigen for generating specific antibodies against chicken SLC30A7, which can then be used for immunolocalization studies.

  3. Functional assays: The protein can be reconstituted into liposomes or membrane systems to study zinc transport kinetics and mechanisms.

  4. Protein-protein interaction studies: The His-tagged protein facilitates pull-down assays to identify binding partners and regulatory proteins.

  5. Comparative studies: Chicken SLC30A7 can be used in comparative analyses with zinc transporters from other species to understand evolutionary conservation and divergence.

Reconstitution Protocols

The proper reconstitution of lyophilized recombinant chicken SLC30A7 is critical for maintaining its structural integrity and functional properties. Manufacturer recommendations suggest briefly centrifuging the vial prior to opening to bring the contents to the bottom . The protein should be reconstituted in deionized sterile water to achieve a concentration between 0.1 and 1.0 mg/mL. For long-term storage, the addition of glycerol to a final concentration of 5-50% is recommended, with 50% glycerol being the standard recommendation for most applications .

Stability and Quality Control

The stability of recombinant chicken SLC30A7 can be affected by various factors, including temperature fluctuations, pH changes, and exposure to proteases. To ensure the highest quality for experimental use, it is important to avoid repeated freeze-thaw cycles and to store working aliquots at 4°C for no more than one week . The protein's purity should be verified through SDS-PAGE analysis, with commercial preparations typically guaranteeing greater than 90% purity .

Comparison with Alternative Expression Systems

While E. coli is commonly used for the expression of recombinant chicken SLC30A7, alternative expression systems may offer advantages for specific applications. Cell-free expression systems provide another option for protein production, potentially offering benefits in terms of folding and post-translational modifications . The choice of expression system should be guided by the specific requirements of the intended research application, with considerations for protein yield, purity, and functional activity.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will fulfill your request based on availability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All protein shipments are standardly sent with blue ice packs. If dry ice shipping is required, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquotting at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us and we will prioritize developing the specified tag.
Synonyms
SLC30A7; ZNT7; Zinc transporter 7; ZnT-7; Solute carrier family 30 member 7
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-378
Protein Length
full length protein
Species
Gallus gallus (Chicken)
Target Names
Target Protein Sequence
MLPLSIKDDEYKPPRLNLFRKMSGWFRSILADKTSRNLFFFLCLNLSFAFVELLYGVWSN SLGLISDSFHMFFDCTALLAGLAASVISKWRSNDAFSYGYVRAEVLAGFVNGLFLIFTAF FIFSEGVERALEPPDVHHERLLPVSILGFIVNLIGIFVFQHGGHGHSHGSGHEHSHSLFN GGLSHGHSHRGHGHSHEHKHGHTHDHGHSHGLSHGQDYCHDDHCLEGMTGSSKQILQGVF LHIVADTLGSIGVIISAILMQNYGLMIADPICSMLIALLIGVSIVPLLKESIGILMQRTP PSLENALPQCYQRVQQLQGVYSLHDPHFWTLCTDVYIGTLKLLVAPDADGRWILSQTHNI FTQAGVRQLYIQIDVAAM
Uniprot No.

Target Background

Function
This protein appears to facilitate zinc transport from the cytoplasm into the Golgi apparatus. It plays a partial role in regulating cellular zinc homeostasis. It is required in conjunction with ZNT5 for the activation of zinc-requiring enzymes, alkaline phosphatases (ALPs). It transports zinc into the lumens of the Golgi apparatus and vesicular compartments where ALPs reside, converting apoALPs to holoALPs. In collaboration with ZNT5 and ZNT6, it is essential for the activation of TNAP.
Gene References Into Functions
  1. contributes to the conversion of apo-alkaline phosphatase to holo-alkaline phosphatase PMID: 15525635
  2. ZnT5(-)ZnT7(-/-) cells exhibited exacerbated unfolded protein response, similar to wild-type cells cultured under zinc-deficient conditions. This indicates that both complexes contribute to maintaining homeostatic function in the secretory pathway PMID: 16636052
Database Links
Protein Families
Cation diffusion facilitator (CDF) transporter (TC 2.A.4) family, SLC30A subfamily
Subcellular Location
Golgi apparatus, trans-Golgi network membrane; Multi-pass membrane protein.

Q&A

What is the structural organization of chicken SLC30A7 (ZnT7) and how does it compare to mammalian homologs?

Chicken SLC30A7, like its human counterpart, belongs to the SLC30 family of zinc transporters that mobilize cytosolic zinc to intracellular compartments, particularly the Golgi apparatus. Structurally, ZnT7 exists as a homodimer with each protomer containing six transmembrane helices (TM1b-TM6) with both N and C termini facing the cytosol . The protein adopts a "mushroom-shaped" dimeric architecture with tight packing between the transmembrane domains (TMDs) and cytosolic domains (CTDs) of the two protomers . Unlike the "V-shaped" dimers of hZnT8 and EcYiiP that have less tight interactions between the TMDs, ZnT7 forms a more compact structure similar to SoYiiP .

Each ZnT7 protomer contains a single zinc-binding site in its transmembrane domain. A distinctive feature of ZnT7 is its exceptionally long cytosolic histidine-rich loop, which can bind at least two Zn²⁺ ions and likely facilitates zinc recruitment from the cytosol to the transport pathway . Chicken ZnT7 shares these core structural features while maintaining species-specific amino acid variations that may influence substrate specificity or regulatory mechanisms.

How is chicken ZnT7 expressed during development and in different tissues?

Chicken ZnT7 is primarily localized to the Golgi apparatus, specifically at the proximal side of the Golgi complex . While tissue-specific expression patterns in chickens require further characterization, research on mammalian ZnT7 indicates it plays essential roles in dietary zinc absorption and regulation of body adiposity . Expression patterns typically vary across developmental stages and tissues, with higher expression expected in tissues with significant zinc-dependent protein synthesis and secretion.

The expression of ZnT7 is likely regulated by zinc availability through transcriptional mechanisms similar to those observed for other zinc transporters. Under zinc-deficient conditions, expression may increase to maximize zinc utilization efficiency in critical tissues. Temporal expression analysis during embryonic development would be particularly valuable for understanding the role of ZnT7 in avian organogenesis.

What are the primary functions of chicken ZnT7 at the cellular level?

Chicken ZnT7 functions as a Zn²⁺/H⁺ antiporter that transports zinc from the cytosol into the Golgi lumen, utilizing proton motive force as the energy source . This transport activity maintains zinc concentration in the Golgi at approximately 25 nM or higher . The primary functions include:

  • Supplying zinc to the lumen of the early secretory pathway compartments for incorporation into newly synthesized zinc-dependent enzymes

  • Contributing to the regulation of GPI-anchored protein expression on the cell surface

  • Participating in the intracellular localization and trafficking of ER-Golgi cycling chaperones such as ERp44

  • Maintaining zinc homeostasis in secretory pathway functions

ZnT7's function is critical for the metalation of zinc ectoenzymes at their active sites, a process essential for their proper folding, stability, and enzymatic activity . Loss of ZnT7 function results in significant reduction in GPI-anchored protein levels, similar to effects seen in mutants lacking phosphatidylinositol glycan anchor biosynthesis genes .

What experimental approaches are most effective for studying the role of chicken ZnT7 in zinc-dependent cellular processes?

To effectively study chicken ZnT7's role in zinc-dependent cellular processes, researchers should consider a multi-faceted approach combining genetic, biochemical, and imaging techniques:

  • CRISPR/Cas9-mediated gene editing: Generation of ZnT7-knockout chicken cell lines allows assessment of phenotypic consequences and identification of zinc-dependent processes that rely specifically on ZnT7 .

  • Overexpression and complementation studies: Expression of wild-type or mutant ZnT7 in knockout cells helps determine structure-function relationships and rescue effects .

  • Zinc transport assays: Measurement of zinc transport into the Golgi using zinc-specific fluorescent probes like Zinpyr-1 localized to the Golgi apparatus provides direct evidence of ZnT7 function.

  • Proteomics and interactomics: SWATH-MS analysis can be employed to identify proteins whose expression is altered in ZnT7-deficient cells, particularly GPI-anchored proteins and zinc ectoenzymes .

  • Live-cell imaging: Tracking the localization and trafficking of GFP-tagged ZnT7 in response to zinc availability or cellular stress provides insights into its dynamic regulation.

  • Activity assays for zinc-dependent enzymes: Measuring the activity of Golgi-resident or secreted zinc-dependent enzymes in control versus ZnT7-deficient cells helps establish the functional consequences of ZnT7 loss .

Combining these approaches with appropriate controls allows for comprehensive characterization of ZnT7's specific contributions to zinc-dependent cellular processes in avian cells.

How does chicken ZnT7 interact with other proteins in the secretory pathway?

Chicken ZnT7 likely engages in multiple protein-protein interactions within the secretory pathway that are critical for its function and regulation. Based on studies of mammalian ZnT7, potential interaction partners include:

  • ERp44: Human ZnT7 has been shown to contribute to the regulation of ERp44 localization and trafficking . This ER-Golgi cycling chaperone plays a key role in protein quality control, suggesting ZnT7 may indirectly influence secretory protein maturation.

  • GPI-anchored proteins: ZnT7 is essential for the proper expression of GPI-anchored proteins on the cell surface . While this may primarily reflect ZnT7's role in zinc supply, direct interactions with GPI biosynthetic machinery cannot be ruled out.

  • Zinc-dependent enzymes: ZnT7 activates zinc ectoenzymes through zinc metalation at their active sites . This process may involve transient interactions that facilitate zinc transfer.

  • Other zinc transporters: ZnT7 functions redundantly with ZNT5-ZNT6 heterodimers in supplying zinc to the early secretory pathway . This functional redundancy might involve coordinated regulation through protein-protein interactions.

  • Golgi resident proteins: Interactions with Golgi membrane proteins likely contribute to ZnT7's specific localization within the Golgi apparatus.

Methodologically, co-immunoprecipitation followed by mass spectrometry, proximity labeling techniques like BioID, or yeast two-hybrid screening can be employed to identify novel ZnT7 interaction partners in chicken cells.

What are the optimal conditions for expressing and purifying recombinant chicken ZnT7 for structural studies?

Expressing and purifying recombinant chicken ZnT7 for structural studies requires careful optimization to maintain protein stability and functionality. Based on successful approaches with human ZnT7 , the following protocol is recommended:

  • Expression system selection:

    • Mammalian expression systems (HEK293F or GnTI- cells) are preferred for proper folding and post-translational modifications

    • Insect cell systems (Sf9 or Hi5) may offer higher yield while maintaining proper folding

  • Construct design:

    • Include an N-terminal affinity tag (His8 or Twin-Strep) separated by a TEV protease cleavage site

    • Consider truncating flexible regions that may hinder crystallization but maintain the core transmembrane domain and essential cytosolic regions

    • Introduce thermostabilizing mutations based on homology modeling if needed

  • Expression conditions:

    • Culture temperature: 30°C for initial growth, then reduce to 27°C post-induction

    • Induction time: 48-72 hours for optimal expression

    • Supplement with 10-20 μM ZnCl₂ to stabilize the protein during expression

  • Purification protocol:

    • Solubilize membranes with 1% (w/v) n-dodecyl-β-D-maltopyranoside (DDM)

    • Include 150 mM NaCl, 20 mM Tris-HCl (pH 8.0), and 10% glycerol in all buffers

    • Add 0.1 mM ZnCl₂ or 1 mM EDTA depending on whether zinc-bound or zinc-free states are desired

    • Exchange detergent to lauryl maltose neopentyl glycol (LMNG) during purification

    • Include a final size-exclusion chromatography step

  • Quality control:

    • Assess protein purity by SDS-PAGE (>95% purity required)

    • Verify conformational homogeneity by analytical size-exclusion chromatography

    • Confirm functionality through zinc binding assays

For cryo-EM studies, preparing antibody fragment (Fab) complexes with purified ZnT7 may improve particle orientation distribution and image contrast, as successfully demonstrated with human ZnT7 .

What functional assays can be used to measure chicken ZnT7 transport activity in vitro and in cellular systems?

Several complementary approaches can be employed to assess chicken ZnT7 transport activity:

In vitro assays:

  • Reconstituted proteoliposome assays:

    • Purified ZnT7 is reconstituted into liposomes with controlled internal pH

    • ⁶⁵Zn uptake is measured in the presence of pH gradients

    • Kinetic parameters (Km, Vmax) can be determined under varying conditions

  • Zinc-binding assays:

    • Isothermal titration calorimetry (ITC) to determine zinc binding affinity and stoichiometry

    • Fluorescence spectroscopy using zinc-sensitive fluorophores to monitor binding dynamics

Cellular assays:

  • Genetically-encoded zinc sensors:

    • Transfect cells with Golgi-targeted zinc sensors (e.g., Golgi-ZapCY1)

    • Monitor changes in FRET ratio in response to zinc supplementation or depletion

    • Compare zinc uptake kinetics in wild-type versus ZnT7-deficient cells

  • Radioisotope uptake:

    • Measure ⁶⁵Zn accumulation in Golgi fractions isolated from cells

    • Compare uptake in control cells versus those overexpressing or lacking ZnT7

  • Zinc-dependent enzyme activity:

    • Monitor the activity of zinc ectoenzymes as readouts of functional zinc transport

    • Compare enzymatic activity in ZnT7-deficient cells with wild-type or rescued cells

  • GPI-anchored protein expression:

    • Quantify cell surface expression of GPI-anchored proteins by flow cytometry

    • Use this as an indirect measure of ZnT7 functional activity

A comprehensive assessment of ZnT7 function should combine multiple approaches to distinguish direct transport activity from secondary effects on zinc-dependent cellular processes.

How can researchers effectively analyze the impact of point mutations on chicken ZnT7 function?

To systematically analyze the impact of point mutations on chicken ZnT7 function, researchers should implement a structured approach combining computational prediction, experimental validation, and functional characterization:

  • Mutation selection strategy:

    • Target conserved residues identified through multiple sequence alignment of ZnT7 across species

    • Focus on residues in the predicted zinc-binding site (e.g., the HDHD motif)

    • Examine the histidine-rich loop, which plays a crucial role in zinc recruitment

    • Investigate residues at the dimer interface to assess their role in protein stability and function

  • Computational analysis:

    • Perform homology modeling based on human ZnT7 cryo-EM structures

    • Use molecular dynamics simulations to predict mutation effects on protein stability and dynamics

    • Calculate changes in zinc binding energy for mutations in coordinate residues

  • Expression and localization assessment:

    • Generate expression constructs with mutations of interest

    • Analyze protein expression levels by Western blotting

    • Confirm proper Golgi localization using immunofluorescence microscopy

  • Functional characterization:

    • Measure zinc transport activity using methods described in FAQ 3.2

    • Assess the ability of mutant ZnT7 to rescue defects in ZnT7-knockout cells

    • Evaluate effects on the expression and activity of zinc-dependent enzymes

  • Structural validation:

    • For mutations with significant functional effects, consider structural studies (if feasible)

    • Use hydrogen-deuterium exchange mass spectrometry to examine conformational changes

    • Perform crosslinking studies to assess changes in protein-protein interactions

This integrated approach allows for comprehensive characterization of structure-function relationships in chicken ZnT7 and provides insights into the molecular mechanisms of zinc transport.

How should researchers interpret contradictory results between in vitro and cellular studies of chicken ZnT7?

When facing contradictory results between in vitro and cellular studies of chicken ZnT7, researchers should systematically evaluate potential sources of discrepancy:

  • Context-dependent protein function:

    • ZnT7 functions in the complex Golgi environment with specific lipid composition and pH

    • In vitro systems may lack cofactors or interaction partners present in cells

    • Consider whether reconstituted systems adequately mimic the native membrane environment

  • Redundancy with other zinc transporters:

    • ZnT7 functions redundantly with ZNT5-ZNT6 heterodimers in supplying zinc to the early secretory pathway

    • Cellular studies may not reveal the full phenotype unless both systems are inactivated

    • Compare results from single ZnT7 knockout with ZnT5/ZnT7 double knockout systems

  • Experimental validation strategies:

    • Confirm protein expression and proper localization in both systems

    • Verify zinc binding capacity using direct biochemical measurements

    • Assess protein stability and folding under experimental conditions

  • Reconciliation approaches:

    • Design hybrid experiments that bridge in vitro and cellular contexts

    • Use semi-permeabilized cell systems to control cytosolic environment

    • Apply specific inhibitors to isolate ZnT7 function from redundant systems

  • Biological interpretation framework:

    • Consider evolutionary context and species-specific adaptations

    • Assess whether discrepancies reflect regulatory mechanisms

    • Evaluate whether contradictions reveal novel aspects of zinc homeostasis

When publishing results, transparently report contradictory findings and propose testable hypotheses to resolve discrepancies, advancing understanding of ZnT7 biology rather than selecting data that supports a preferred narrative.

What statistical approaches are most appropriate for analyzing zinc transport data in ZnT7 studies?

Analyzing zinc transport data requires careful statistical consideration to account for the complexities of transmembrane transport processes:

  • Experimental design considerations:

    • Include biological replicates (n≥3) to account for cell-to-cell variability

    • Perform technical replicates to assess measurement precision

    • Include appropriate positive and negative controls in each experiment

  • Data normalization strategies:

    • Normalize transport activity to protein expression levels

    • Account for differences in cell number or membrane surface area

    • Consider normalizing to internal standards when comparing across experiments

  • Kinetic data analysis:

    • For concentration-dependent studies, fit data to appropriate transport models:

      • Michaelis-Menten equation for simple transport

      • Hill equation if cooperativity is suspected

      • More complex models for multiple binding sites or allosteric effects

    • Use non-linear regression rather than linear transformations

  • Statistical tests for hypothesis testing:

    • For comparing two conditions: paired t-test or Wilcoxon signed-rank test

    • For multiple conditions: ANOVA with appropriate post-hoc tests (Tukey, Dunnett)

    • For non-normally distributed data: non-parametric alternatives

  • Advanced analytical approaches:

    • Consider Bayesian statistical methods for complex datasets

    • Apply principal component analysis to identify patterns in multivariate data

    • Use mixed-effects models to account for random and fixed effects

Statistical TestApplicationAdvantagesLimitations
Paired t-testComparing two related conditionsAccounts for paired measurementsRequires normal distribution
ANOVAComparing multiple conditionsControls family-wise error rateAssumes equal variances
Non-linear regressionFitting kinetic parametersDirectly models biological processesRequires sufficient data points
Bayesian analysisComplex systems with prior knowledgeIncorporates uncertaintyComputationally intensive

When reporting results, include both raw data and processed results, clearly describe statistical methods used, and provide measures of variability (standard deviation or standard error) along with exact p-values.

How can researchers effectively compare chicken ZnT7 function with mammalian orthologs?

Effective comparison of chicken ZnT7 with mammalian orthologs requires a systematic approach that accounts for both sequence and functional conservation:

  • Sequence-based comparative analysis:

    • Perform multiple sequence alignment to identify conserved domains and motifs

    • Calculate sequence identity and similarity percentages for full-length proteins and functional domains

    • Identify species-specific insertions, deletions, or substitutions, particularly in the:

      • Transmembrane zinc-binding site (HDHD motif)

      • Histidine-rich loop

      • Dimer interface regions

  • Structural comparison:

    • Generate homology models based on human ZnT7 cryo-EM structures

    • Compare predicted structural features, especially zinc coordination geometry

    • Analyze differences in surface electrostatics that might affect ion selectivity

  • Functional complementation experiments:

    • Express chicken ZnT7 in mammalian cells lacking endogenous ZnT7

    • Assess whether chicken ZnT7 can rescue phenotypes of mammalian ZnT7 deficiency

    • Quantify the efficiency of complementation relative to species-matched controls

  • Regulatory mechanism comparison:

    • Analyze promoter regions for conserved transcription factor binding sites

    • Compare post-translational modifications using mass spectrometry

    • Investigate protein-protein interactions using cross-species pulldown assays

  • Evolutionary context assessment:

    • Consider evolutionary pressures specific to avian zinc metabolism

    • Examine whether functional differences correlate with dietary or physiological adaptations

    • Analyze conservation in the context of the whole zinc transporter family

This comparative approach provides insights not only into the fundamental mechanisms of zinc transport conserved across species but also highlights adaptations that may reflect species-specific physiological requirements for zinc homeostasis.

What are the most promising approaches for studying the role of chicken ZnT7 in avian development and physiology?

Several innovative approaches show significant promise for advancing our understanding of chicken ZnT7's role in avian development and physiology:

  • Genome editing in avian models:

    • CRISPR/Cas9-mediated generation of ZnT7-knockout or knock-in chickens

    • Creation of reporter lines with fluorescently tagged ZnT7 for in vivo imaging

    • Development of conditional knockout systems to study tissue-specific functions

  • Single-cell transcriptomics and proteomics:

    • Mapping ZnT7 expression patterns across developmental stages and tissues

    • Identifying cell types most dependent on ZnT7 function

    • Characterizing compensatory responses to ZnT7 deficiency

  • In vivo zinc imaging:

    • Application of zinc-sensitive fluorescent probes to embryos and tissues

    • Development of genetically encoded zinc sensors targeted to specific subcellular compartments

    • Real-time imaging of zinc dynamics during development and in response to dietary changes

  • Integrative physiological studies:

    • Analysis of the impact of ZnT7 manipulation on zinc absorption and distribution

    • Investigation of links between ZnT7 function and immune development

    • Exploration of ZnT7's role in skeletal development and egg shell formation

  • Translational research applications:

    • Development of strategies to enhance zinc utilization efficiency in poultry

    • Investigation of ZnT7 polymorphisms associated with production traits

    • Examination of ZnT7 regulation in response to environmental stressors

These approaches, particularly when combined in multidisciplinary studies, promise to reveal ZnT7's integrative role in coordinating zinc homeostasis across tissues and developmental stages in avian species.

How might structural information about ZnT7 inform the development of selective modulators of zinc transport?

Structural insights into ZnT7 provide a foundation for rational design of selective modulators that could serve as research tools or potential therapeutic agents:

  • Structure-based targeting strategies:

    • Focus on unique features of ZnT7 structure, particularly the histidine-rich loop that facilitates zinc recruitment

    • Target the zinc transport pathway at the transition point between inward-facing and outward-facing conformations

    • Design molecules that stabilize specific conformational states to inhibit or enhance transport

  • Potential binding sites for selective modulators:

    • The cytosolic zinc entry site, which contains a negatively charged cavity in the inward-facing conformation

    • The transmembrane zinc-binding site featuring the HDHD motif

    • Allosteric sites at the dimer interface that could influence conformational dynamics

  • Design considerations for selectivity:

    • Target regions with low sequence conservation among ZnT family members

    • Exploit the "mushroom-shaped" dimeric architecture of ZnT7 that distinguishes it from other ZnTs

    • Account for species-specific variations to develop modulators with defined cross-species activity profiles

  • Screening approaches:

    • Structure-based virtual screening against the ZnT7 transport pathway

    • Fragment-based drug discovery targeting hotspots identified in cryo-EM structures

    • Development of high-throughput assays based on zinc transport or conformational changes

  • Validation strategies:

    • Test candidate modulators in reconstituted systems and cellular models

    • Evaluate specificity across the ZnT family using CRISPR-edited cell lines

    • Assess effects on zinc-dependent processes in relevant physiological contexts

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.