Recombinant Chikungunya virus Structural polyprotein, partial

Shipped with Ice Packs
In Stock

Description

Definition and Composition

The Recombinant Chikungunya Virus Structural Polyprotein, partial refers to a genetically engineered protein complex derived from the structural polyprotein of Chikungunya virus (CHIKV). CHIKV, an alphavirus, encodes structural proteins (Capsid, E3, E2, 6K/TF, and E1) that form the viral particle . The "partial" designation indicates that this recombinant construct does not include the full-length polyprotein but rather specific domains or cleavage products critical for viral assembly or functional studies .

Role in Viral Life Cycle

The structural polyprotein is processed during CHIKV infection to generate mature virion components:

  • Capsid: Binds viral RNA to form the nucleocapsid core .

  • E2 and E1 glycoproteins: Form heterodimers on the virion surface, mediating host cell attachment and membrane fusion .

  • 6K/TF: A small hydrophobic protein involved in virion budding .

Proteolytic cleavage of the polyprotein is executed by the viral capsid protease (CP), a self-processing enzyme within the structural polyprotein .

Production Methods

Recombinant structural polyproteins are produced using heterologous expression systems:

Expression SystemProteins ExpressedApplications
Baculovirus Capsid, E2, E1Drug screening, antigen production
AAV vectors Full-length structural polyproteinVaccine development, immune response studies
E. coli Capsid protease (CP) domainProteolytic activity assays

For example, recombinant baculovirus systems enable high-yield co-expression of structural proteins with fluorescent markers (e.g., EGFP) for tracking , while AAV-based platforms allow single-dose immunization studies .

Vaccine Design

  • AAV-based vaccines: A single-dose recombinant AAV encoding CHIKV structural proteins (Capsid-E3-E2-6K-E1) elicits neutralizing antibodies and T-cell responses in preclinical models .

  • Virus-like particles (VLPs): Recombinant structural proteins self-assemble into non-infectious VLPs, mimicking native virions for immune activation .

Drug Screening

  • FRET-based assays: Recombinant CP domains are used to screen protease inhibitors targeting the structural polyprotein cleavage .

Functional Studies

StudyKey OutcomeReference
AAV vaccine efficacyRobust IgG/IgM responses and viral clearance in mice
CP protease activityCys478 residue essential for proteolytic function
Baculovirus expressionHigh-titer production of E2/E1 glycoproteins

Challenges and Future Directions

  • Pre-existing immunity: Vector-specific immune responses (e.g., to AAV or baculovirus) may limit vaccine efficacy .

  • Protein processing: Incomplete cleavage of recombinant polyproteins can yield non-functional intermediates .

  • Structural resolution: Cryo-EM and tomography are needed to resolve conformational dynamics during polyprotein maturation .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
Structural polyprotein; p130
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
810-1248
Protein Length
Partial
Species
Chikungunya virus (strain Nagpur) (CHIKV)
Target Protein Sequence
YEHVTVIPNTVGVPYKTLVNRPGYSPMVLEMELLSVTLEPTLSLDYITCEYKTVIPSPYV KCLRYSECKDKSLPDYSCKVFTGVYPFMWGGAYCFCDTENTQLSEAHVEKSESCKTEFAS AYRAHTASASGKLRVLYQGNNVTVSAYANGDHAVTVKDAKFIVGPMSSAWTPFDNKIVVY KGDVYNMDYPPFGAGRPGQFGDIQSRTPESEDVYANTQLVLQRPSAGTVHVPYSQAPSGF KYWLKERGASLQHTAPFGCQIATNPVRAMNCAVGNMPISIDIPDAAFTRVVDAPSLTDMS CEVPACTHSSDFGGAAIIKYAASKKGKCAVHSMTNAVTIREAEIEVEGNSQLQISFSTAL ASAEFRVQVCSTQVHCAAECHPPKDHIVNYPASHTTLGVQDISATAMSWVQKITGGVGLV VAVAALILIVVLCVSFSRH
Uniprot No.

Target Background

Function
The Chikungunya virus structural polyprotein, a partial component, is a complex protein that plays a crucial role in the virus's lifecycle and interaction with host cells. It forms an icosahedral capsid with T=4 symmetry, composed of 240 copies of the capsid protein. This capsid is enveloped by a lipid membrane through which 80 spikes protrude. These spikes are trimers of E1-E2 heterodimers. The capsid protein binds to the viral RNA genome at a site adjacent to the ribosome binding site, facilitating viral genome translation after genome release. It exhibits protease activity, resulting in its autocatalytic cleavage from the nascent structural protein. Following self-cleavage, the capsid protein transiently associates with ribosomes. Within minutes, it binds to viral RNA and rapidly assembles into icosahedral core particles. The resulting nucleocapsid eventually associates with the cytoplasmic domain of the spike glycoprotein E2 at the cell membrane, leading to budding and formation of mature virions.

During infection, new virions attach to target cells, undergoing clathrin-mediated endocytosis. Their membrane then fuses with the host endosomal membrane, releasing the nucleocapsid into the cytoplasm. This is followed by uncoating, a process essential for making the genomic RNA accessible. Uncoating may be triggered by the interaction of capsid proteins with ribosomes. Binding of ribosomes could release the genomic RNA, as the same region binds both genomic RNA and ribosomes.

The structural polyprotein exhibits several key functions that contribute to the virus's pathogenesis and evasion of the host immune system. Specifically, it inhibits interleukin-1 receptor-associated kinase 1 (IRAK1)-dependent signaling during viral entry. This represents a mechanism by which the alphaviruses evade innate immune detection and activation prior to viral gene expression. The polyprotein degrades host cyclic GMP-AMP synthase (cGAS), effectively inhibiting the cGAS-STING pathway.

The protein E3/E2 precursor is translocated to the host endoplasmic reticulum using a signal sequence provided by the structural polyprotein. Furin cleaved E3 remains associated with spike glycoprotein E1, contributing to the pH protection of E1 during transport through the secretory pathway. After virion release from the host cell, assembly protein E3 is gradually released into the extracellular space.

The E2 glycoprotein plays a key role in viral attachment to the target host cell by binding to the cell receptor. It is synthesized as a p62 precursor, which is processed by furin at the cell membrane just before virion budding. This process generates the E2-E1 heterodimer. The p62-E1 heterodimer is stable, whereas E2-E1 is unstable and dissociates at low pH. p62 undergoes its final processing step, presumably to prevent E1 fusion activation before its final export to the cell surface. The E2 C-terminus contains a transitory transmembrane domain that is disrupted by palmitoylation, leading to reorientation of the C-terminal tail from the lumenal to the cytoplasmic side. This step is critical as the E2 C-terminus interacts with capsid proteins during budding. The release of E2 C-terminus into the cytoplasm occurs late in protein export, preventing premature particle assembly at the endoplasmic reticulum membrane.

The 6K protein is a constitutive membrane protein involved in virus glycoprotein processing, cell permeabilization, and budding of viral particles. It disrupts calcium homeostasis in the cell, likely at the endoplasmic reticulum level, leading to cytoplasmic calcium elevation. Due to its lipophilic properties, 6K is thought to influence the selection of lipids that interact with the transmembrane domains of glycoproteins, affecting the deformability of the bilayer required for the extreme curvature during budding. 6K is present in virions at low levels, approximately 3% compared to viral glycoproteins.

The E1 glycoprotein functions as a class II viral fusion protein. Its fusion activity remains inactive as long as E1 is bound to E2 in the mature virion. After virus attachment to the target cell and endocytosis, the acidification of the endosome induces dissociation of the E1/E2 heterodimer, leading to trimerization of E1 subunits. This E1 trimer becomes fusion-active and promotes the release of the viral nucleocapsid into the cytoplasm after fusion between the endosome and viral membrane. Efficient fusion requires the presence of cholesterol and sphingolipid in the target membrane. Optimal fusion occurs at levels of approximately one molecule of cholesterol for every two molecules of phospholipids and is specific for sterols containing a 3-beta-hydroxyl group.
Subcellular Location
[Capsid protein]: Virion. Host cytoplasm. Host cell membrane. Host nucleus.; [Spike glycoprotein E2]: Virion membrane; Single-pass type I membrane protein. Host cell membrane; Single-pass type I membrane protein.; [6K protein]: Host cell membrane; Multi-pass membrane protein. Virion membrane; Multi-pass membrane protein.; [Spike glycoprotein E1]: Virion membrane; Single-pass type I membrane protein. Host cell membrane; Single-pass type I membrane protein.

Q&A

Basic Research Questions

  • What constitutes the Chikungunya virus structural polyprotein?

The Chikungunya virus (CHIKV) structural polyprotein is encoded by the 3' open reading frame (ORF) of the viral genome and translated from a subgenomic RNA. It consists of five proteins arranged in the order: Capsid-E3-E2-6K-E1 . The capsid protein forms the nucleocapsid that encapsulates the viral RNA genome. E3 serves as a chaperone for E2 during processing. E2 and E1 are transmembrane glycoproteins that form heterodimers exposed on the virion surface as viral spikes, while 6K/TF is a small membrane protein involved in virion assembly and budding .

  • What are the key functions of each component in the CHIKV structural polyprotein?

The CHIKV structural polyprotein components serve distinct functions essential for viral assembly and infection:

  • Capsid: Associates with genomic RNA to form the central nucleocapsid of the virion and possesses autoproteolytic activity that releases it from the nascent polyprotein

  • E3: Functions as a chaperone protein essential for proper folding of E2 and prevention of premature fusion activation

  • E2: Mediates viral binding to host receptors and facilitates viral attachment to cells

  • 6K/TF: Small hydrophobic protein involved in virus assembly and budding

  • E1: Mediates fusion between virus and endosome membranes after viral entry

This arrangement ensures that all components necessary for virion structure and function are produced in appropriate quantities and undergo correct processing.

  • Why is the E2 glycoprotein considered a preferred target for CHIKV vaccine development?

The E2 glycoprotein is considered a primary target for CHIKV vaccine development because neutralizing antibodies predominantly target this protein . As the receptor-binding protein exposed on the virion surface, E2 contains critical domains that mediate host cell attachment. Antibodies binding to E2 can effectively block these interactions, thereby preventing infection. Studies have demonstrated that vaccines expressing the E2 protein or the full-length structural polyprotein can elicit robust neutralizing antibody responses that confer protection against CHIKV infection in animal models .

  • What considerations are important when designing expression systems for the CHIKV structural polyprotein?

When designing expression systems for the CHIKV structural polyprotein, researchers must consider:

  • Gene size: The encoding sequence for the full-length structural polyprotein (Capsid-E3-E2-6K-E1) is approximately 3.7 kb, which exceeds the packaging capacity (~3.3 kb) of some viral vectors like AAV

  • Processing requirements: The polyprotein requires sequential processing by viral and cellular proteases for functional maturation

  • Post-translational modifications: CHIKV envelope proteins require proper glycosylation and disulfide bond formation for correct folding and immunogenicity

  • Expression level: Different vector systems yield varying levels of protein expression

  • Cellular toxicity: Some viral proteins may exhibit toxicity when overexpressed

For optimal results, expression systems should support appropriate protein processing and modifications while maximizing yield and maintaining protein functionality.

  • How is the CHIKV structural polyprotein processed after translation?

The CHIKV structural polyprotein undergoes sequential proteolytic processing:

  • Initial translation produces the full Capsid-E3-E2-6K-E1 polyprotein

  • The capsid protein, with its cis-proteolytic activity, cleaves itself from the polyprotein first

  • Host cell signal peptidases in the endoplasmic reticulum process the remaining E3-E2-6K-E1 portion

  • The E3-E2 precursor (p62) is subsequently cleaved by cellular furin protease in the trans-Golgi network to generate mature E3 and E2 proteins

  • After processing, E2 and E1 form heterodimers essential for viral infectivity and are transported to the plasma membrane for virion assembly

This ordered processing sequence ensures proper folding and function of each structural protein.

Advanced Research Questions

  • What are the challenges and solutions for expressing the full-length CHIKV structural polyprotein in recombinant systems?

Expressing the full-length CHIKV structural polyprotein in recombinant systems presents several challenges:

ChallengeSolution ApproachEvidence
Size constraints (3.7 kb exceeds some vector capacities)Optimization of vector design; use of larger capacity vectorsAAV1, AAV5, AAV8, and AAV9 can package the full polyprotein gene with titers >10^7 GC/μL, while AAV2 and AAV6 show reduced efficiency
Proper protein processingUse of mammalian expression systems that contain necessary proteasesHEK-293T cells successfully process the polyprotein as demonstrated by Western blot detection of correctly sized E2 protein
Membrane association requirementsSelection of vectors with strong tropism for target cellsAAV1 shows good transduction efficiency in mouse skeletal muscle and has been approved for gene therapy applications
Conformational authenticityCo-expression of chaperones; optimization of expression conditionsCo-expression of E3 with E2, expression at lower temperatures (28-30°C) improves proper folding

Recent research has demonstrated successful packaging and expression of the complete CHIKV structural polyprotein using optimized AAV vectors despite the size constraints, with efficient expression of E2 protein detectable by both immunofluorescence and Western blot analysis .

  • How do different viral vectors compare for expressing CHIKV structural proteins?

Different viral vectors exhibit varying capabilities for CHIKV structural protein expression:

Vector TypePackaging CapacityExpression CharacteristicsCurrent Development Status
AAV~3.3-4.7 kb (serotype dependent)AAV1, AAV5, AAV8, and AAV9 generate comparable amounts of rAAV-CHIKV-SP (>10^7 GC/μL); AAV2 and AAV6 show lower efficiency Single dose intramuscular injection of rAAV1-CHIKV-SP elicits high-level, long-lasting antibody responses with complete protection in animal models
Adenovirus~7-8 kbHigh transduction efficiency in multiple cell types; Ph1 clinical trials underway Adenovirus-vectored vaccines expressing CHIKV structural proteins show promising safety and immunogenicity profiles
Measles Virus>6 kbGood for lymphoid cell targeting; currently in Ph2 clinical trials Represents a promising vaccine candidate with good safety and efficacy data

The selection of an appropriate vector system should be based on specific research objectives, considering factors such as required expression levels, target tissue tropism, safety profile, and production scalability. Recent studies indicate that despite size constraints, AAV vectors can successfully express the CHIKV structural polyprotein with high efficiency, particularly AAV1 for muscle-targeted expression .

  • What is the structural organization of CHIKV replication complexes and how do structural proteins interact with non-structural proteins?

CHIKV replication occurs in specialized membrane structures called spherules, with a complex organization involving both non-structural and structural proteins:

  • Spherule structure: CHIKV forms membrane invaginations (spherules) at the plasma membrane that serve as viral replication organelles

  • nsP1 arrangement: The non-structural protein 1 (nsP1) assembles into a dodecameric ring forming a pore-like structure at the neck of the spherule

  • Functional complex: The nsP1 pore acts as a capping machinery for viral RNA and may allow passage of proteins up to 70-90 kDa in size

  • RNA transport: The pore structure likely facilitates transport of newly synthesized viral RNAs to the cytosol for translation and packaging

Cryo-electron tomography has revealed that nsP1 serves as a base for the assembly of a larger protein complex at the neck of the membrane bud . This complex architecture is essential for viral replication and represents a potential target for antiviral development. The structural polyproteins are translated from subgenomic RNA produced by this replication machinery, creating an interconnected system where both protein types contribute to viral propagation .

  • What methodological approaches are most effective for evaluating the immunogenicity of recombinant CHIKV structural proteins?

Effective evaluation of recombinant CHIKV structural protein immunogenicity requires multiple complementary approaches:

  • Antibody response characterization:

    • ELISA assays to quantify binding antibodies against individual structural proteins

    • Plaque reduction neutralization tests (PRNT) to measure functional neutralizing antibodies

    • Western blot analysis to confirm recognition of properly folded proteins

    • Flow cytometry to detect antibodies binding to cell-surface expressed proteins

  • Cellular immunity assessment:

    • ELISpot assays to enumerate antigen-specific T-cell responses

    • Intracellular cytokine staining to characterize T-cell functionality

    • T-cell proliferation assays to measure antigen-specific expansion

  • Animal model studies:

    • Single-dose intramuscular injection of rAAV1-CHIKV-SP has demonstrated high-level, long-lasting antibody responses and complete protection against challenge

    • Challenge studies evaluating viremia reduction, joint pathology prevention, and survival

  • Structural authenticity verification:

    • Differential binding of conformation-dependent monoclonal antibodies

    • Mass spectrometry to confirm appropriate post-translational modifications

    • Electron microscopy of virus-like particles if applicable

A comprehensive immunogenicity evaluation should address both humoral and cellular aspects of immunity while confirming structural authenticity of the expressed proteins.

  • How does the viral capping mechanism of CHIKV nsP1 relate to structural protein expression and function?

The viral capping mechanism performed by CHIKV nsP1 is integrally linked to structural protein expression and function:

  • Biochemical pathway: CHIKV nsP1 possesses both methyltransferase and guanylyltransferase activities required for capping viral RNAs

  • Cryo-EM structures reveal that nsP1 forms capping pores that carry out the RNA capping pathway

  • Five distinct conformational states representing different steps of the reaction have been identified

  • Functional significance for structural proteins:

  • Proper capping of the subgenomic RNA is essential for efficient translation of structural polyproteins

  • Capped RNAs evade cellular innate immune sensors, enabling robust structural protein expression

  • The nsP1 capping mechanism differs from host capping pathways, making it a potential target for selective inhibition

  • Structural organization:

  • Upon membrane binding, nsP1 assembles into a dodecameric ring forming a pore-like structure

  • This structure may function as a "bioreactor" simultaneously capping multiple RNA molecules during export to the cytosol

  • The capping machinery contributes to the exceptionally high alphavirus replication rate, supporting abundant structural protein synthesis

Understanding the nsP1 capping mechanism provides insights for developing antivirals that could inhibit structural protein expression by blocking cap formation, thus preventing viral assembly and spread .

  • What role do CHIKV structural proteins play in determining viral tissue tropism and pathogenesis?

CHIKV structural proteins significantly influence tissue tropism and pathogenesis through multiple mechanisms:

  • Receptor interactions:

    • E2 glycoprotein mediates binding to cellular receptors including MXRA8, which shows high expression in musculoskeletal tissues

    • Recent genome-wide CRISPR-Cas9 screening identified FHL1 (Four-and-a-half LIM domain protein 1) as an important host factor dictating CHIKV tropism for muscles and joints

    • The E2-receptor interaction specificity influences which cell types can be infected

  • Fusion activity:

    • E1 glycoprotein mediates membrane fusion following endocytosis, with its activity influenced by endosomal pH in different tissue types

    • Mutations in the fusion peptide can alter tissue tropism by changing fusion efficiency in different cellular environments

  • Immunological consequences:

    • Structural proteins are major targets for neutralizing antibodies

    • Persistence of structural proteins in musculoskeletal tissues may contribute to chronic arthralgia through sustained immune responses

    • Specific epitopes on structural proteins may trigger autoimmune-like responses contributing to chronic symptoms

  • Viral assembly and budding:

    • Efficient assembly and budding from specific tissues contributes to viral load and dissemination

    • The capsid protein's interaction with host factors can influence cell-type-specific viral production

Understanding these mechanisms provides potential targets for therapeutic intervention to limit CHIKV tissue damage and persistent symptoms. The identification of tissue-specific factors like FHL1 represents a significant advance in understanding CHIKV's predilection for musculoskeletal tissues .

  • How can researchers optimize codon usage for maximum expression of recombinant CHIKV structural polyprotein?

Optimizing codon usage for CHIKV structural polyprotein expression requires a multifaceted approach:

Successful implementation of these strategies has enabled efficient expression of the full 3.7kb CHIKV structural polyprotein despite its size exceeding typical AAV packaging limitations .

  • What are the current state-of-the-art methods for assessing neutralizing antibody responses against recombinant CHIKV structural proteins?

State-of-the-art methods for assessing neutralizing antibody responses include:

  • Classical virus neutralization assays:

    • Plaque Reduction Neutralization Test (PRNT): The gold standard measuring antibody capacity to reduce viral plaque formation

    • Microneutralization assay: Higher throughput variant using cytopathic effect or immunostaining as readouts

  • Reporter-based systems:

    • Pseudotyped particles: Reporter viruses (lentivirus, VSV) displaying CHIKV envelope proteins with luciferase or GFP readouts

    • Reporter virus particles: CHIKV variants engineered to express reporter genes upon successful infection

  • Binding inhibition assays:

    • Flow cytometry-based assays measuring inhibition of recombinant E2 binding to cell surface receptors

    • Competition ELISAs with known neutralizing monoclonal antibodies

  • Advanced structural approaches:

    • Biolayer interferometry measuring kinetics of antibody binding to recombinant proteins

    • Hydrogen-deuterium exchange mass spectrometry to map epitopes recognized by neutralizing antibodies

    • Cryo-EM visualization of antibody-envelope protein complexes

  • In vivo correlates of protection:

    • Passive transfer studies measuring protection conferred by serum antibodies

    • Viral load reduction in tissues following challenge of immunized animals

These methods provide complementary information about different aspects of neutralizing antibody responses. Studies with rAAV1-CHIKV-SP have demonstrated that single-dose vaccination can elicit high-level, long-lasting antibody responses that confer complete protection in animal models .

  • How do different CHIKV lineages and variants affect recombinant structural protein design?

CHIKV lineages and variants present important considerations for recombinant structural protein design:

  • Genetic diversity:

    • CHIKV exists as three distinct genotypes: West African, East/Central/South African (ECSA), and Asian

    • Amino acid sequence variation in structural proteins ranges from 2-5% between lineages

    • The E1-A226V mutation that emerged during the 2005-2006 Indian Ocean outbreak enhanced viral fitness in Aedes albopictus mosquitoes

  • Epitope conservation and variation:

    • Neutralizing epitopes show varying degrees of conservation across lineages

    • Critical neutralizing epitopes on E2 domain B are generally well-conserved

    • Domain A of E2 shows higher variability and may require lineage-specific approaches

  • Structural protein design strategies:

    • Consensus sequences derived from multiple isolates can create broadly reactive antigens

    • Mosaic antigens incorporating epitopes from multiple lineages may elicit broader responses

    • Inclusion of dominant circulating strains may be necessary for region-specific vaccines

  • Multi-lineage coverage assessment:

    • Cross-neutralization testing against diverse CHIKV isolates is essential

    • Structural analysis of antibody binding to variant epitopes helps predict cross-protection

    • Animal challenge studies with heterologous strains confirm broad protection

Current vaccine approaches, including the rAAV vector expressing CHIKV structural polyprotein, typically utilize sequences from well-characterized epidemic strains, with evaluation against multiple lineages to confirm broad coverage .

  • What are the latest advances in understanding interactions between CHIKV structural and non-structural proteins?

Recent advances have revealed complex interactions between CHIKV structural and non-structural proteins:

  • Replication complex architecture:

    • Cryo-electron tomography has revealed that nsP1 forms a base for assembly of a larger protein complex at the membrane bud neck

    • This complex likely includes both non-structural and structural components for efficient viral replication and assembly

    • The nsP1 dodecameric ring creates a pore-like structure compatible with trafficking proteins up to 70-90 kDa

  • RNA capping and structural protein expression:

    • Five distinct cryo-EM structures of nsP1 represent different steps of the RNA capping reaction

    • This capping is essential for efficient translation of structural proteins and evasion of innate immunity

    • The nsP1 capping mechanism exhibits reversibility, allowing capping and decapping of RNAs

  • Spherule formation and viral assembly:

    • Minimal requirements for alphavirus spherule formation include nsP4 + P123

    • Structural proteins likely interact with these replication complexes for efficient packaging of genomic RNA

    • nsP1's interaction with membranes dramatically reshapes lipid bilayers, contributing to spherule creation

  • Immune evasion strategies:

    • Non-structural proteins like nsP2 and nsP3 may protect structural proteins from immune responses

    • nsP3 forms condensates that sequester host factors and may protect viral RNA and structural proteins

These discoveries provide new targets for antiviral development and improve our understanding of viral replication dynamics. The structural basis of the CHIKV capping pathway offers particular promise for designing antivirals targeting viral RNA capping to block alphaviral infection .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.