Recombinant Chimpanzee hepatitis B virus Large envelope protein (S)

Shipped with Ice Packs
In Stock

Description

Host Specificity and Receptor Interaction

  • The pre-S1 domain (residues 1–40) determines host tropism. Substituting the first 30 amino acids of HBV pre-S1 into woolly monkey HBV (WMHBV) restores infectivity in human hepatocytes .

  • Myristoylation of pre-S1 is indispensable for infectivity, as non-myristoylated mutants fail to mediate viral entry .

Role in HDV Pseudotyping

  • HBV L protein is required for hepatitis D virus (HDV) infectivity. Particles lacking L protein (S or SM configurations) show 10,000-fold lower infectivity compared to SML particles .

Vaccine Development

  • Recombinant HBsAg produced in CHO cells elicits stronger antibody and cellular immune responses in chimpanzees compared to plasma-derived or yeast-derived vaccines .

  • Vaccinated chimpanzees showed cross-protection against HBV subtypes ad and ay .

Infectivity Dose Dependency

Inoculum Dose (Genome Equivalents)Infection Outcome in Chimpanzees
10¹⁰, 10⁷, 10⁴Acute infection, viral clearance
10Chronic infection (50% rate)

Low-dose inocula correlate with delayed CD4⁺/CD8⁺ T-cell responses and prolonged infection .

Competitive Inhibition Studies

Synthetic pre-S1 peptides block HBV and WMHBV pseudotyped HDV infection in hepatocytes:

Peptide Sequence (HBV pre-S1)Inhibition Efficiency (Human Hepatocytes)
1–3095%
1–2070%
1–1020%

Substitutions in residues 9–18 of pre-S1 reduce infectivity by >90% .

Applications and Implications

  • Vaccine Design: Recombinant S proteins are foundational to HBV vaccines due to high immunogenicity .

  • Antiviral Targets: Pre-S1 peptides (e.g., Myrcludex B) inhibit viral entry and are in clinical trials .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please communicate with us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
S; Large envelope protein; L glycoprotein; L-HBsAg; LHB; Large S protein; Large surface protein; Major surface antigen
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-389
Protein Length
Full Length of Mature Protein
Species
Chimpanzee hepatitis B virus (isolate United Kingdom/LSH/1988) (HBVcpz)
Target Names
S
Target Protein Sequence
GQNLSTSNPLGFFPEHQLDPAFKANTNNPDWDFNPKKDYWPEATKVGAGAFGPGFTPPHG GLLGLSPQAQGILTTLPANPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQALQ DPRVRGLYFPAGGSSSGTLNPVPNTASHISSVFSTTGDPAPNMENITSGFLGPLLVLQAG FFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLR RFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSLIPSCC CTKPSDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLAPFVQWFAGLSPTVWLLAIWMM WYWGPNLYNILSPFIPLLPIFFCLWVYI
Uniprot No.

Target Background

Function
The large envelope protein exists in two topological conformations: 'external' or Le-HBsAg and 'internal' or Li-HBsAg. In its external conformation, the protein attaches the virus to cell receptors, initiating infection. This interaction determines species specificity and liver tropism. Attachment induces virion internalization primarily through caveolin-mediated endocytosis. The large envelope protein also facilitates fusion between the virion membrane and the endosomal membrane. In its internal conformation, the protein contributes to virion morphogenesis and acts as a matrix protein, mediating contact with the nucleocapsid. The middle envelope protein plays a crucial role in virion budding. It induces budding independently of the nucleocapsid, resulting in the formation of subviral lipoprotein particles with a diameter of 22 nm that lack a nucleocapsid.
Protein Families
Orthohepadnavirus major surface antigen family
Subcellular Location
Virion membrane.

Q&A

What is the significance of chimpanzee HBV large envelope protein in viral research?

The chimpanzee HBV large envelope protein serves as a critical component in understanding HBV infections, particularly because chimpanzees are the only nonhuman primate model fully susceptible to HBV infection. This protein plays a fundamental role in viral entry, assembly, and immune system interactions. The chimpanzee model has been instrumental in elucidating the molecular mechanisms of HBV pathogenesis, enabling the development of vaccines and antiviral therapies that are currently in use . The recombinant form of this protein allows researchers to study specific structural and functional aspects without requiring complete virus particles, making it valuable for both basic science investigations and translational research.

How do the structural characteristics of chimpanzee HBV large envelope protein compare to human HBV variants?

Chimpanzee HBV large envelope protein shares significant structural homology with human HBV variants, making it an excellent model for comparative studies. The protein contains three domains: pre-S1, pre-S2, and S (surface antigen) regions, with the S domain being the most conserved across species. Research has demonstrated that HBV variants with mutations in the surface protein, such as the strain AS with an arginine substitution for glycine at surface gene codon 145, remain infectious and pathogenic in chimpanzees . These structural similarities enable researchers to use chimpanzee models for studying neutralizing antibody responses and investigating potential escape mutations that might arise in human populations. The high degree of conservation in key functional domains explains why chimpanzees develop cellular immune responses similar to those observed in humans during HBV infection .

What are the key historical developments in recombinant chimpanzee HBV envelope protein research?

Research on recombinant chimpanzee HBV envelope proteins has evolved significantly since the 1970s when researchers first demonstrated that chimpanzees were susceptible to human HBV. Early studies established that chimpanzees could be infected with HBV present in human plasma and could develop both acute and chronic infections similar to humans . In the late 1970s and early 1980s, the development of recombinant DNA technology enabled the production of recombinant HBV proteins, which led to groundbreaking vaccine development. These advances facilitated comprehensive studies of viral replication intermediates and covalently closed circular DNA (cccDNA) in infected chimpanzee livers . The chimpanzee model was instrumental in testing vaccine efficacy against various HBV subtypes and mutant strains, including surface protein variants, which established the cross-protective nature of antibodies generated against the envelope proteins .

What are the optimal expression systems for producing recombinant chimpanzee HBV large envelope protein?

The production of recombinant chimpanzee HBV large envelope protein can be accomplished using several expression systems, each with distinct advantages depending on research objectives. Based on established protocols for HBV research, the most effective systems include:

Expression SystemAdvantagesLimitationsYield (mg/L)Post-translational Modifications
Mammalian Cells (CHO, HEK293)Native-like glycosylation patterns; proper foldingHigher cost; longer production time10-50Extensive and human-like
Insect Cells (Sf9, High Five™)Higher yield than mammalian; some glycosylationDifferent glycosylation pattern from mammals50-200Limited compared to mammalian
Yeast (P. pastoris)High yield; cost-effectiveHypermannosylation; potential folding issues100-500Different from mammalian systems
E. coliHighest yield; simplest protocolNo glycosylation; inclusion body formation200-800Minimal to none

For studies focused on immunological properties and receptor binding, mammalian cell lines are preferred due to their ability to produce proteins with proper post-translational modifications. When producing recombinant surface proteins for structural studies, researchers should carefully consider how expression systems might affect protein conformation and epitope presentation, as these factors have been crucial in previous successful vaccine development efforts using chimpanzee models .

How should researchers design experiments to evaluate neutralizing antibodies against recombinant chimpanzee HBV large envelope protein?

Designing experiments to evaluate neutralizing antibodies against recombinant chimpanzee HBV large envelope protein requires a multi-faceted approach. Based on established methodologies from successful studies:

  • In vitro neutralization assays: Researchers should first develop cell culture systems that express the appropriate receptors for viral entry. The neutralization capacity can be assessed by pre-incubating the recombinant protein or virus particles with test antibodies before adding to susceptible cells.

  • Epitope mapping: Perform systematic analyses using overlapping peptides derived from the large envelope protein to identify specific binding regions of neutralizing antibodies. This approach has been particularly valuable in identifying the "a" determinant within the S region as a critical neutralization domain.

  • Cross-reactivity testing: Evaluate antibody binding to both wild-type and mutant variants of the envelope protein. Previous research demonstrated that antibodies generated against standard vaccine strains could recognize mutant surface antigen by competition ELISA, suggesting broad neutralization potential .

  • In vivo challenge studies: For definitive evaluation, properly immunized chimpanzees can be challenged with infectious HBV to assess protection. Historical studies have shown that chimpanzees immunized with recombinant hepatitis B vaccines developed broadly reactive antibodies that protected against infection with surface gene mutant strains of HBV .

  • Longitudinal antibody analysis: Monitor antibody titers and neutralization capacity over time to assess durability of protection, as long-term immunity has been documented in previous chimpanzee studies .

This comprehensive approach allows researchers to characterize both the breadth and potency of neutralizing antibody responses against various epitopes of the large envelope protein.

What techniques are most effective for studying the interaction between recombinant chimpanzee HBV large envelope protein and host receptors?

To effectively study interactions between recombinant chimpanzee HBV large envelope protein and host receptors, researchers should employ a combination of advanced techniques:

When applying these techniques, researchers should consider that chimpanzee HBV models have historically provided critical insights into viral entry mechanisms that were later confirmed in human studies. The chimpanzee model has been particularly valuable because it recapitulates the complete viral life cycle with a cellular immune response similar to that observed in humans .

How can researchers effectively measure the immunogenicity of different epitopes within the recombinant chimpanzee HBV large envelope protein?

Measuring immunogenicity of different epitopes within the recombinant chimpanzee HBV large envelope protein requires a comprehensive approach that combines multiple analytical techniques:

  • Peptide Microarrays: Develop overlapping peptide libraries spanning the entire large envelope protein sequence and screen against sera from vaccinated or naturally infected chimpanzees. This permits identification of linear epitopes recognized by antibodies.

  • Conformational Epitope Mapping: Utilize techniques such as hydrogen-deuterium exchange mass spectrometry (HDX-MS) or alanine scanning mutagenesis to identify conformational epitopes that may not be detected by linear peptide mapping.

  • T-Cell Epitope Characterization: Implement ELISPOT assays to measure IFN-γ production by T cells in response to specific peptides. Research has shown that chimpanzee class I MHC molecules share overlapping peptide-binding specificities with human HLA supertypes, making T-cell epitope studies in chimpanzees relevant to human immunity .

  • Competitive Binding Assays: Develop assays to determine if antibodies against different epitopes compete for binding, indicating spatial proximity on the protein surface.

  • Structural Analysis: Combine epitope mapping data with structural information from X-ray crystallography or cryo-EM to visualize epitope accessibility on the protein surface.

Previous research demonstrated that chimpanzees immunized with licensed recombinant hepatitis B vaccines developed antibodies that recognized both wild-type and mutant surface antigens, suggesting that vaccination elicits antibodies against multiple epitopes, providing broad protection .

How should researchers interpret conflicting results between in vitro neutralization and in vivo protection studies with recombinant chimpanzee HBV large envelope protein?

When faced with discrepancies between in vitro neutralization and in vivo protection studies involving recombinant chimpanzee HBV large envelope protein, researchers should consider several factors:

  • Neutralization Mechanisms: In vitro assays may not capture all potential neutralization mechanisms present in vivo. While in vitro assays typically measure direct blocking of virus-receptor interactions, in vivo protection may involve additional mechanisms such as antibody-dependent cellular cytotoxicity (ADCC), complement activation, or enhanced clearance of opsonized particles.

  • Antibody Diversity and Maturation: The polyclonal antibody response in vivo is more diverse than what can be modeled in vitro. Historical studies have shown that vaccinated chimpanzees develop broadly reactive antibodies that can recognize both wild-type and mutant surface antigens, potentially explaining better in vivo protection than predicted by in vitro assays .

  • Role of T-Cell Immunity: Protection in vivo may be significantly enhanced by T-cell responses not measured in neutralization assays. Research has demonstrated that properly activated HBV-specific CD8+ T cells play a crucial role in controlling infection by killing infected cells and secreting IFN-γ, which triggers antiviral responses in the liver .

  • Infectious Dose Considerations: The infectious dose used in challenge studies affects the stringency of protection tests. Studies have shown that chimpanzees can be infected with as little as one genome equivalent of HBV DNA , which may require higher antibody titers for protection than predicted by in vitro assays.

  • Liver Microenvironment Effects: The unique immunological environment of the liver, which cannot be fully recapitulated in vitro, may significantly influence protection outcomes.

When encountering contradictory results, researchers should attempt to harmonize findings by developing more sophisticated in vitro systems that better mimic in vivo conditions and by conducting more detailed analyses of immune responses in protected versus infected animals.

What methodological approaches should be used when comparing immune responses to wild-type versus mutant variants of recombinant chimpanzee HBV large envelope protein?

When comparing immune responses to wild-type versus mutant variants of recombinant chimpanzee HBV large envelope protein, researchers should implement the following methodological approaches:

  • Standardized Protein Quantification: Ensure equal amounts of wild-type and mutant proteins are used across all experiments by employing multiple quantification methods (e.g., BCA assay, quantitative amino acid analysis, and quantitative Western blotting).

  • Parallel Serological Testing: Analyze sera from the same subjects against both variants simultaneously using standardized ELISA or multiplex bead-based assays to minimize inter-assay variability. Historical studies used competition ELISA to demonstrate that antibodies from vaccinated chimpanzees could recognize both wild-type and mutant surface antigens .

  • Cross-Adsorption Studies: Perform cross-adsorption experiments where sera are pre-incubated with one variant before testing reactivity against the other to identify shared versus unique epitopes.

  • Functional Antibody Assessments:

    • Neutralization capacity comparisons using standardized reporter virus systems

    • Antibody-dependent cellular cytotoxicity (ADCC) potency

    • Complement activation potential

    • Fc receptor engagement properties

  • T-Cell Response Analysis: Compare T-cell epitope recognition patterns using:

    • IFN-γ ELISPOT assays with overlapping peptide pools

    • Intracellular cytokine staining (ICS) to measure polyfunctional T-cell responses

    • TCR repertoire analysis to assess clonal diversity in response to each variant

  • In Vivo Cross-Protection Studies: Challenge immunized animals with both variants to assess cross-protection efficacy. Previous research has demonstrated that licensed recombinant hepatitis B vaccines protected chimpanzees against challenge with a surface gene mutant (strain AS), suggesting broad protective capacity despite sequence differences .

By implementing these methodological approaches, researchers can thoroughly characterize differences in immune recognition and protection efficacy, which is crucial for vaccine development strategies targeting emerging HBV variants.

What are the primary challenges in translating findings from recombinant chimpanzee HBV large envelope protein studies to human applications?

The translation of findings from recombinant chimpanzee HBV large envelope protein studies to human applications faces several significant challenges:

  • Species-Specific Immune Differences: Despite similarities, chimpanzee and human immune systems have distinct differences in receptor expression patterns, cytokine responses, and immunoregulatory mechanisms. While chimpanzees develop cellular immune responses similar to humans, the severity of hepatitis consistently appears milder in HBV-infected chimpanzees compared to human patients .

  • Ethical and Regulatory Constraints: Increasing restrictions on chimpanzee research by the National Institutes of Health (NIH) and other agencies limit new studies. Historical research provided invaluable insights, but future validation studies may need alternative approaches .

  • Viral Genetic Diversity Challenges: Chimpanzee studies typically use limited viral strains, whereas human populations encounter diverse HBV genotypes and variants. Previous research identified HBV strains indigenous to chimpanzees and other nonhuman primates that differ from human strains .

  • Difficulty in Modeling Chronic Infection: While acute infection models in chimpanzees are well-established, chronic infection occurs at a relatively low rate (5-10%) similar to humans, making it challenging to study chronicity mechanisms and develop therapies for chronic hepatitis B .

  • Alternative Model System Limitations: Potential alternative models (e.g., woodchucks, humanized mice) each have significant limitations compared to the chimpanzee model. Whether these models can adequately replace chimpanzees for HBV research remains uncertain .

  • Scalability Issues: Findings from small-scale chimpanzee studies require validation in larger human cohorts with greater genetic and environmental diversity before clinical application.

Despite these challenges, historical chimpanzee research has already contributed significantly to successful human applications, including the development of effective HBV vaccines and improved safety of blood products .

What emerging technologies might enhance research on recombinant chimpanzee HBV large envelope protein structure-function relationships?

Several emerging technologies show promise for advancing research on recombinant chimpanzee HBV large envelope protein structure-function relationships:

  • AlphaFold and Other AI-Driven Structural Prediction Tools: These computational approaches can predict protein structures with near-experimental accuracy, potentially revealing subtle conformational differences between wild-type and mutant envelope proteins that affect receptor binding or antibody recognition.

  • Single-Cell Multi-Omics Integration: Combining single-cell transcriptomics, proteomics, and epigenomics to comprehensively characterize host cell responses to envelope protein variants at unprecedented resolution. This approach builds upon historical studies that used DNA microarray analyses to investigate host-virus interactions in chimpanzee liver biopsies .

  • Organoid Technologies: Liver organoids derived from human or chimpanzee stem cells provide physiologically relevant 3D culture systems for studying envelope protein interactions with differentiated hepatocytes in a complex tissue-like environment.

  • CRISPR-Based Screening Platforms: High-throughput CRISPR screens can identify host factors that interact with the envelope protein, building upon historical studies of virus-host interactions during HBV infection in chimpanzees .

  • Advanced Microscopy Techniques:

    • Super-resolution microscopy for visualizing envelope protein trafficking and localization

    • Lattice light-sheet microscopy for real-time imaging of virus-host interactions

    • Correlative light and electron microscopy (CLEM) for connecting functional data with ultrastructural context

  • Microfluidic Organ-on-Chip Models: These systems can recreate the liver microenvironment with controlled fluid flow and cell-cell interactions, potentially providing more physiologically relevant models than traditional cell culture while reducing reliance on animal models.

  • In Silico Epitope Mapping and Vaccine Design: Computational tools can predict both B-cell and T-cell epitopes and guide rational design of next-generation vaccines targeting specific regions of the envelope protein, building on historical cross-challenging studies that demonstrated cross-protection between HBV subtypes in chimpanzees .

Implementation of these emerging technologies may help overcome some of the ethical and practical limitations of chimpanzee research while continuing to advance our understanding of HBV envelope protein biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.