Recombinant Chlamydia muridarum 3-deoxy-D-manno-octulosonic-acid transferase (waaA)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
waaA; kdtA; TC_0480; 3-deoxy-D-manno-octulosonic acid transferase; Kdo transferase; Kdo(2-lipid IV(A 3-deoxy-D-manno-octulosonic acid transferase; Kdo-lipid IV(A 3-deoxy-D-manno-octulosonic acid transferase; Lipid IV(A 3-deoxy-D-manno-octulosonic acid transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-430
Protein Length
full length protein
Species
Chlamydia muridarum (strain MoPn / Nigg)
Target Names
waaA
Target Protein Sequence
MRRWLTSRLYDAFLVAAFLAAAPRIFYKVVFHGKYINSWKIRFGVEKPQVKGEGPLVWFH
GASVGEVSLLEPLLKKWRQEFPDWRFVVTACSEAGVYTAQRLYAPLGATVFVLPLDLSCI
INPVVRSLSPQVVIFSEGDCWLHFLMGAKKLGAKAFLINGKLSENSCKRFAFLKRLGRSY
FAPLDLLVLQDKVYKQRFMQIGIPEDKIQISGNLKTFIETETSINNRSLWRKKLKLSPSD
RLIVLGSMHPKDVEVWADVAQHFNKFSTKILWVPRHLEKLKEHARLLEKAGISFGLWSKE
DSLLQYDSLIVDAMGILKDLYSAADLAFVGGTFDPLVGGHNLLEPLQKEVPLMFGPHIHS
QSVLAELLRTKEVGVSVDKENLLEAVENLLEDEKKRQAYIERGKSFLKNAGTSFEHTWEI
LKSQIACIKI
Uniprot No.
Target Background
Function
Recombinant Chlamydia muridarum 3-deoxy-D-manno-octulosonic-acid transferase (WaaA) is involved in lipopolysaccharide (LPS) biosynthesis. This enzyme catalyzes the transfer of three 3-deoxy-D-manno-octulosonate (Kdo) residues from CMP-Kdo to lipid IV(A), the tetraacyldisaccharide-1,4'-bisphosphate precursor of lipid A. This process generates the genus-specific LPS epitope of Chlamydia, a trisaccharide with the structure α-Kdo-(2→8)-α-Kdo-(2→4)-α-Kdo.
Database Links
KEGG: cmu:TC_0480
STRING: 243161.CmurN_010100002433
Protein Families
Glycosyltransferase group 1 family, Glycosyltransferase 30 subfamily
Subcellular Location
Cell inner membrane; Single-pass membrane protein; Cytoplasmic side.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
